O75610 · LFTY1_HUMAN
- ProteinLeft-right determination factor 1
- GeneLEFTY1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids366 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Required for left-right axis determination as a regulator of LEFTY2 and NODAL.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Molecular Function | cytokine activity | |
Molecular Function | growth factor activity | |
Molecular Function | transforming growth factor beta receptor binding | |
Biological Process | anterior/posterior axis specification | |
Biological Process | determination of left/right symmetry | |
Biological Process | heart morphogenesis | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | transforming growth factor beta receptor signaling pathway |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameLeft-right determination factor 1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO75610
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_052567 | 57 | in dbSNP:rs35273824 | |||
Sequence: V → M | ||||||
Natural variant | VAR_070888 | 92 | in dbSNP:rs145431393 | |||
Sequence: L → S | ||||||
Natural variant | VAR_070889 | 142 | in dbSNP:rs191758097 | |||
Sequence: R → Q | ||||||
Natural variant | VAR_024231 | 322 | in dbSNP:rs360057 | |||
Sequence: D → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 481 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, propeptide, chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-21 | |||||
Sequence: MQPLWLCWALWVLPLASPGAA | ||||||
Propeptide | PRO_0000033810 | 22-76 | Or 135 | |||
Sequence: LTGEQLLGSLLRQLQLKEVPTLDRADMEELVIPTHVRAQYVALLQRSHGDRSRGK | ||||||
Chain | PRO_0000033811 | 77-366 | Left-right determination factor 1 | |||
Sequence: RFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSCASDGALVPRRLQP | ||||||
Glycosylation | 158 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 251↔264 | |||||
Sequence: CDPEAPMTEGTRCC | ||||||
Disulfide bond | 263↔316 | |||||
Sequence: CCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQC | ||||||
Disulfide bond | 293↔351 | |||||
Sequence: CVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKC | ||||||
Disulfide bond | 297↔353 | |||||
Sequence: CRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIKEGGRTRPQVVSLPNMRVQKCSC |
Post-translational modification
The processing of the protein may also occur at the second R-X-X-R site located at AA 132-135. Processing appears to be regulated in a cell-type specific manner.
Keywords
- PTM
Proteomic databases
PTM databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length366
- Mass (Da)40,880
- Last updated1998-11-01 v1
- ChecksumBCF900C71ED9AA2A
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF081507 EMBL· GenBank· DDBJ | AAC33967.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF081504 EMBL· GenBank· DDBJ | AAC33967.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF081505 EMBL· GenBank· DDBJ | AAC33967.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF081506 EMBL· GenBank· DDBJ | AAC33967.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF081512 EMBL· GenBank· DDBJ | AAD48144.1 EMBL· GenBank· DDBJ | mRNA | ||
AY358873 EMBL· GenBank· DDBJ | AAQ89232.1 EMBL· GenBank· DDBJ | mRNA | ||
AK313115 EMBL· GenBank· DDBJ | BAG35937.1 EMBL· GenBank· DDBJ | mRNA | ||
AK222714 EMBL· GenBank· DDBJ | BAD96434.1 EMBL· GenBank· DDBJ | mRNA | ||
AL117348 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC027883 EMBL· GenBank· DDBJ | AAH27883.1 EMBL· GenBank· DDBJ | mRNA |