O75508 · CLD11_HUMAN
- ProteinClaudin-11
- GeneCLDN11
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids207 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | axon | |
Cellular Component | basal part of cell | |
Cellular Component | bicellular tight junction | |
Cellular Component | cell junction | |
Cellular Component | lipid droplet | |
Cellular Component | neurofilament | |
Cellular Component | plasma membrane | |
Cellular Component | tight junction | |
Molecular Function | identical protein binding | |
Molecular Function | structural molecule activity | |
Biological Process | axon ensheathment | |
Biological Process | bicellular tight junction assembly | |
Biological Process | calcium-independent cell-cell adhesion via plasma membrane cell-adhesion molecules | |
Biological Process | cell adhesion | |
Biological Process | spermatogenesis | |
Biological Process | tight junction assembly |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameClaudin-11
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO75508
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1 | Cytoplasmic | ||||
Sequence: M | ||||||
Transmembrane | 2-22 | Helical | ||||
Sequence: VATCLQVVGFVTSFVGWIGVI | ||||||
Topological domain | 23-82 | Extracellular | ||||
Sequence: VTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACR | ||||||
Transmembrane | 83-103 | Helical | ||||
Sequence: ALMIAASVLGLPAILLLLTVL | ||||||
Topological domain | 104-122 | Cytoplasmic | ||||
Sequence: PCIRMGQEPGVAKYRRAQL | ||||||
Transmembrane | 123-143 | Helical | ||||
Sequence: AGVLLILLALCALVATIWFPV | ||||||
Topological domain | 144-157 | Extracellular | ||||
Sequence: CAHRETTIVSFGYS | ||||||
Transmembrane | 158-178 | Helical | ||||
Sequence: LYAGWIGAVLCLVGGCVILCC | ||||||
Topological domain | 179-207 | Cytoplasmic | ||||
Sequence: AGDAQAFGENRFYYTAGSSSPTHAKSAHV |
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Leukodystrophy, hypomyelinating, 22 (HLD22)
- Note
- DescriptionAn autosomal dominant disorder characterized by global developmental delay, mildly impaired intellectual development, motor impairment, limb spasticity, dysarthria, and eye abnormalities including hypermetropia. Brain imaging shows hypomyelinating leukodystrophy.
- See alsoMIM:619328
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 180 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000144760 | 1-207 | UniProt | Claudin-11 | |||
Sequence: MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVDILILPGYVQACRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRAQLAGVLLILLALCALVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTHAKSAHV | |||||||
Modified residue (large scale data) | 191 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 192 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 196 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 197 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 197 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 198 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 198 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 200 | PRIDE | Phosphothreonine | ||||
Sequence: T |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Subunit
Interacts with tetraspanin-3/TSPAN3 (By similarity).
Interacts with OCLN (PubMed:20375010).
Interacts with OCLN (PubMed:20375010).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O75508 | AMIGO1 Q86WK6 | 3 | EBI-12820543, EBI-19125216 | |
BINARY | O75508 | ATN1 Q86V38 | 3 | EBI-12820543, EBI-11954292 | |
BINARY | O75508 | C16orf54 Q6UWD8 | 3 | EBI-12820543, EBI-18041102 | |
BINARY | O75508 | FNDC9 Q8TBE3 | 3 | EBI-12820543, EBI-12142257 | |
BINARY | O75508 | KLK6 Q92876 | 3 | EBI-12820543, EBI-2432309 | |
BINARY | O75508 | KLRC1 P26715 | 3 | EBI-12820543, EBI-9018187 | |
BINARY | O75508 | SHISA3 A0PJX4 | 3 | EBI-12820543, EBI-10171518 | |
BINARY | O75508 | SMIM3 Q9BZL3 | 3 | EBI-12820543, EBI-741850 | |
BINARY | O75508 | SPINT1 O43278-2 | 3 | EBI-12820543, EBI-12078338 | |
BINARY | O75508 | TMEM80 Q96HE8 | 3 | EBI-12820543, EBI-11742770 | |
BINARY | O75508 | TNFSF14 O43557 | 3 | EBI-12820543, EBI-524131 | |
BINARY | O75508 | ZP3 P21754-3 | 3 | EBI-12820543, EBI-17458299 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length207
- Mass (Da)21,993
- Last updated2000-05-30 v2
- Checksum4FF79C676FCAFA47
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 160 | in Ref. 3; AAV38209/AAV38210 | ||||
Sequence: A → T | ||||||
Sequence conflict | 189-207 | in Ref. 1; AAC25187 | ||||
Sequence: RFYYTAGSSSPTHAKSAHV → VSTTLRALAPRLMRRVPTYKRAARLPTEVL |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF068863 EMBL· GenBank· DDBJ | AAC25187.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ245901 EMBL· GenBank· DDBJ | CAB55487.1 EMBL· GenBank· DDBJ | mRNA | ||
BT019402 EMBL· GenBank· DDBJ | AAV38209.1 EMBL· GenBank· DDBJ | mRNA | ||
BT019403 EMBL· GenBank· DDBJ | AAV38210.1 EMBL· GenBank· DDBJ | mRNA | ||
AK312923 EMBL· GenBank· DDBJ | BAG35768.1 EMBL· GenBank· DDBJ | mRNA | ||
CH471052 EMBL· GenBank· DDBJ | EAW78505.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471052 EMBL· GenBank· DDBJ | EAW78509.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC013577 EMBL· GenBank· DDBJ | AAH13577.1 EMBL· GenBank· DDBJ | mRNA |