O75323 · NIPS2_HUMAN
- ProteinProtein NipSnap homolog 2
- GeneNIPSNAP2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids286 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Protein involved in mitophagy by facilitating recruitment of the autophagy machinery required for clearance of damaged mitochondria (PubMed:30982665).
Accumulates on the mitochondria surface in response to mitochondrial depolarization and acts as a 'eat me' signal by recruiting proteins involved in selective autophagy, such as autophagy receptors (CALCOCO2/NDP52, NBR1, SQSTM1/p62, TAX1BP1 and WDFY3/ALFY) and ATG8 family proteins (MAP1LC3A, MAP1LC3B, MAP1LC3C, GABARAP, GABARAPL1 and GABARAPL2) (PubMed:30982665).
Accumulates on the mitochondria surface in response to mitochondrial depolarization and acts as a 'eat me' signal by recruiting proteins involved in selective autophagy, such as autophagy receptors (CALCOCO2/NDP52, NBR1, SQSTM1/p62, TAX1BP1 and WDFY3/ALFY) and ATG8 family proteins (MAP1LC3A, MAP1LC3B, MAP1LC3C, GABARAP, GABARAPL1 and GABARAPL2) (PubMed:30982665).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | mitochondrial matrix | |
Cellular Component | mitochondrial outer membrane | |
Cellular Component | mitochondrion | |
Molecular Function | protein-macromolecule adaptor activity | |
Biological Process | mitochondrion organization | |
Biological Process | mitophagy | |
Biological Process | oxidative phosphorylation | |
Biological Process | positive regulation of high voltage-gated calcium channel activity |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein NipSnap homolog 2
- Short namesNipSnap2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO75323
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 303 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-23 | Mitochondrion | ||||
Sequence: MAARVLRARGAAWAGGLLQRAAP | ||||||
Chain | PRO_0000221148 | 24-286 | Protein NipSnap homolog 2 | |||
Sequence: CSLLPRLRTWTSSSNRSREDSWLKSLFVRKVDPRKDAHSNLLAKKETSNLYKLQFHNVKPECLEAYNKICQEVLPKIHEDKHYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEVMNKLRENKEFLEFRKARSDMLLSRKNQLLLEFSFWNEPVPRSGPNIYELRSYQLRPGTMIEWGNYWARAIRFRQDGNEAVGGFFSQIGQLYMVHHLWAYRDLQTREDIRNAAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSPLQ |
Proteomic databases
PTM databases
Expression
Tissue specificity
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with CALCOCO2/NDP52, NBR1, SQSTM1/p62, TAX1BP1 and WDFY3/ALFY (PubMed:30982665).
Interacts with ATG8 family proteins (MAP1LC3A, MAP1LC3B, MAP1LC3C, GABARAP, GABARAPL1 and GABARAPL2) (PubMed:30982665).
Interacts with VDAC1 (PubMed:26387735).
Interacts with ATG8 family proteins (MAP1LC3A, MAP1LC3B, MAP1LC3C, GABARAP, GABARAPL1 and GABARAPL2) (PubMed:30982665).
Interacts with VDAC1 (PubMed:26387735).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O75323 | GABARAP O95166 | 5 | EBI-307133, EBI-712001 | |
BINARY | O75323 | GABARAPL1 Q9H0R8 | 6 | EBI-307133, EBI-746969 | |
BINARY | O75323 | GABARAPL2 P60520 | 6 | EBI-307133, EBI-720116 | |
BINARY | O75323 | MAP1LC3B Q9GZQ8 | 4 | EBI-307133, EBI-373144 | |
BINARY | O75323 | MAP1LC3C Q9BXW4 | 2 | EBI-307133, EBI-2603996 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
O75323-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length286
- Mass (Da)33,743
- Last updated1998-11-01 v1
- Checksum7ED85297E4DC9D08
O75323-2
- Name2
- Differences from canonical
- 79-148: HNVKPECLEAYNKICQEVLPKIHEDKHYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEVMNKLRENK → KRCCQRFTKINTTLVLWWGLGTRGMASRTKL
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Sequence caution
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 12 | in Ref. 2; CAA04633 | ||||
Sequence: A → P | ||||||
Alternative sequence | VSP_044708 | 79-148 | in isoform 2 | |||
Sequence: HNVKPECLEAYNKICQEVLPKIHEDKHYPCTLVGTWNTWYGEQDQAVHLWRYEGGYPALTEVMNKLRENK → KRCCQRFTKINTTLVLWWGLGTRGMASRTKL |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF029786 EMBL· GenBank· DDBJ | AAC29002.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ001259 EMBL· GenBank· DDBJ | CAA04633.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
BT007112 EMBL· GenBank· DDBJ | AAP35776.1 EMBL· GenBank· DDBJ | mRNA | ||
AK097049 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
CR407612 EMBL· GenBank· DDBJ | CAG28540.1 EMBL· GenBank· DDBJ | mRNA | ||
AC092579 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471140 EMBL· GenBank· DDBJ | EAX07966.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471140 EMBL· GenBank· DDBJ | EAX07967.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC000732 EMBL· GenBank· DDBJ | AAH00732.1 EMBL· GenBank· DDBJ | mRNA | ||
BC001837 EMBL· GenBank· DDBJ | AAH01837.1 EMBL· GenBank· DDBJ | mRNA | ||
BC030821 EMBL· GenBank· DDBJ | AAH30821.1 EMBL· GenBank· DDBJ | mRNA |