O75143 · ATG13_HUMAN
- ProteinAutophagy-related protein 13
- GeneATG13
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids517 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | Atg1/ULK1 kinase complex | |
Cellular Component | autophagosome | |
Cellular Component | cytoplasm | |
Cellular Component | cytosol | |
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | mitochondrion | |
Cellular Component | phagophore assembly site | |
Cellular Component | phagophore assembly site membrane | |
Molecular Function | protein kinase binding | |
Molecular Function | protein kinase regulator activity | |
Molecular Function | protein serine/threonine kinase activator activity | |
Biological Process | autophagosome assembly | |
Biological Process | mitophagy | |
Biological Process | negative regulation of cell population proliferation | |
Biological Process | piecemeal microautophagy of the nucleus | |
Biological Process | positive regulation of autophagy | |
Biological Process | positive regulation of protein targeting to mitochondrion | |
Biological Process | protein localization to phagophore assembly site | |
Biological Process | regulation of protein lipidation | |
Biological Process | response to mitochondrial depolarisation |
Keywords
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameAutophagy-related protein 13
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO75143
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Keywords
- Cellular component
Disease & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 127 | Abolishes interaction with ATG101; when associated with D-133. | ||||
Sequence: S → H | ||||||
Mutagenesis | 131 | Decreases interaction with ATG101; when associated with D-134. | ||||
Sequence: I → D | ||||||
Mutagenesis | 133 | Abolishes interaction with ATG101; when associated with H-127. | ||||
Sequence: R → D | ||||||
Mutagenesis | 134 | Decreases interaction with ATG101; when associated with D-131. | ||||
Sequence: V → D | ||||||
Mutagenesis | 444 | Decreases interaction with MAP1LC3A. | ||||
Sequence: F → A | ||||||
Mutagenesis | 447 | Decreases interaction with MAP1LC3A. | ||||
Sequence: I → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 542 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for modified residue, chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Modified residue | 1 | UniProt | N-acetylmethionine | ||||
Sequence: M | |||||||
Chain | PRO_0000050767 | 1-517 | UniProt | Autophagy-related protein 13 | |||
Sequence: METDLNSQDRKDLDKFIKFFALKTVQVIVQARLGEKICTRSSSSPTGSDWFNLAIKDIPEVTHEAKKALAGQLPAVGRSMCVEISLKTSEGDSMELEIWCLEMNEKCDKEIKVSYTVYNRLSLLLKSLLAITRVTPAYRLSRKQGHEYVILYRIYFGEVQLSGLGEGFQTVRVGTVGTPVGTITLSCAYRINLAFMSTRQFERTPPIMGIIIDHFVDRPYPSSSPMHPCNYRTAGEDTGVIYPSVEDSQEVCTTSFSTSPPSQLSSSRLSYQPAALGVGSADLAYPVVFAAGLNATHPHQLMVPGKEGGVPLAPNQPVHGTQADQERLATCTPSDRTHCAATPSSSEDTETVSNSSEGRASPHDVLETIFVRKVGAFVNKPINQVTLTSLDIPFAMFAPKNLELEDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGNTHDDFVMIDFKPAFSKDDILPMDLGTFYREFQNPPQLSSLSIDIGAQSMAEDLDSLPEKLAVHEKNVREFDAFVETLQ | |||||||
Modified residue (large scale data) | 7 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 332 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 355 | UniProt | Phosphoserine; by ULK1 | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 355 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 356 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 361 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 361 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Interacts with ATG101 (PubMed:19287211, PubMed:19597335, PubMed:26299944).
Interacts with ULK1 (via C-terminus); this interaction is increased in the absence of TMEM39A (PubMed:18936157, PubMed:19287211, PubMed:21855797, PubMed:31806350).
Interacts with ULK2 (via C-terminus) (PubMed:18936157, PubMed:19225151).
Interacts (via the LIR motif) with GABARAP, GABARAPL, GABARAPL2 (PubMed:23043107).
Interacts (via the LIR motif) with MAP1LC3A, MAP1LC3B and MAP1LC3C (PubMed:24290141).
Interacts with TAB2 and TAB3 (PubMed:21976705).
Interacts with C9orf72 (PubMed:27334615).
Interacts with RB1CC1; this interaction is increased in the absence of TMEM39A (PubMed:31806350).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O75143 | ATG101 Q9BSB4 | 21 | EBI-2798775, EBI-2946739 | |
BINARY | O75143 | C9orf72 Q96LT7-1 | 5 | EBI-2798775, EBI-16693635 | |
BINARY | O75143 | C9orf72 Q96LT7-2 | 4 | EBI-2798775, EBI-16693673 | |
BINARY | O75143 | GABARAP O95166 | 3 | EBI-2798775, EBI-712001 | |
BINARY | O75143 | GABARAPL1 Q9H0R8 | 2 | EBI-2798775, EBI-746969 | |
BINARY | O75143 | GABARAPL2 P60520 | 4 | EBI-2798775, EBI-720116 | |
BINARY | O75143 | MAP1LC3A Q9H492-1 | 7 | EBI-2798775, EBI-16082793 | |
BINARY | O75143 | MAP1LC3B Q9GZQ8 | 5 | EBI-2798775, EBI-373144 | |
BINARY | O75143 | MAP1LC3C Q9BXW4 | 8 | EBI-2798775, EBI-2603996 | |
BINARY | O75143 | OFD1 O75665 | 4 | EBI-2798775, EBI-716327 | |
BINARY | O75143 | RB1CC1 Q8TDY2 | 11 | EBI-2798775, EBI-1047793 | |
BINARY | O75143 | ULK1 O75385 | 15 | EBI-2798775, EBI-908831 | |
BINARY | O75143-2 | ATG101 Q9BSB4 | 3 | EBI-20151086, EBI-2946739 | |
BINARY | O75143-2 | CBX5 P45973 | 3 | EBI-20151086, EBI-78219 | |
BINARY | O75143-2 | TGFBR2 P37173 | 3 | EBI-20151086, EBI-296151 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 127-134 | Important for interaction with ATG101 | ||||
Sequence: SLLAITRV | ||||||
Region | 305-324 | Disordered | ||||
Sequence: GKEGGVPLAPNQPVHGTQAD | ||||||
Region | 332-361 | Disordered | ||||
Sequence: TPSDRTHCAATPSSSEDTETVSNSSEGRAS | ||||||
Region | 405-439 | Disordered | ||||
Sequence: EDTDPMVNPPDSPETESPLQGSLHSDGSSGGSSGN | ||||||
Compositional bias | 417-439 | Polar residues | ||||
Sequence: PETESPLQGSLHSDGSSGGSSGN | ||||||
Motif | 444-447 | LIR | ||||
Sequence: FVMI |
Domain
Sequence similarities
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 5 isoforms produced by Alternative splicing. Experimental confirmation may be lacking for some isoforms.
O75143-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length517
- Mass (Da)56,572
- Last updated1998-11-01 v1
- Checksum4D6905985EAB78A7
O75143-2
- Name2
- Differences from canonical
- 265-301: Missing
O75143-3
- Name3
O75143-4
- Name4
O75143-5
- Name5
- Differences from canonical
- 262-262: S → SQCVFTVTKAHFQTPTPVVTDTLRVPMAGLAFSH
Computationally mapped potential isoform sequences
There are 13 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
J9JIF6 | J9JIF6_HUMAN | ATG13 | 198 | ||
J3KRU6 | J3KRU6_HUMAN | ATG13 | 56 | ||
J3KST9 | J3KST9_HUMAN | ATG13 | 33 | ||
H0YF43 | H0YF43_HUMAN | ATG13 | 42 | ||
H0YEM7 | H0YEM7_HUMAN | ATG13 | 193 | ||
H0YDR0 | H0YDR0_HUMAN | ATG13 | 47 | ||
H0YCL5 | H0YCL5_HUMAN | ATG13 | 78 | ||
A0A1B0GXJ3 | A0A1B0GXJ3_HUMAN | ATG13 | 32 | ||
E9PPR2 | E9PPR2_HUMAN | ATG13 | 119 | ||
J3QLH7 | J3QLH7_HUMAN | ATG13 | 13 | ||
J3QR83 | J3QR83_HUMAN | ATG13 | 38 | ||
J3QR16 | J3QR16_HUMAN | ATG13 | 27 | ||
J3QRL1 | J3QRL1_HUMAN | ATG13 | 50 |
Sequence caution
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_044503 | 1-79 | in isoform 4 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_044640 | 262 | in isoform 5 | |||
Sequence: S → SQCVFTVTKAHFQTPTPVVTDTLRVPMAGLAFSH | ||||||
Alternative sequence | VSP_044504 | 263-299 | in isoform 4 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_002431 | 265-301 | in isoform 2 and isoform 3 | |||
Sequence: Missing | ||||||
Compositional bias | 417-439 | Polar residues | ||||
Sequence: PETESPLQGSLHSDGSSGGSSGN | ||||||
Alternative sequence | VSP_002432 | 428-442 | in isoform 3 | |||
Sequence: HSDGSSGGSSGNTHD → PCSWPLPCLLSPSTV | ||||||
Alternative sequence | VSP_002433 | 443-517 | in isoform 3 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB014552 EMBL· GenBank· DDBJ | BAA31627.2 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK023867 EMBL· GenBank· DDBJ | BAB14707.1 EMBL· GenBank· DDBJ | mRNA | ||
AK294110 EMBL· GenBank· DDBJ | BAG57445.1 EMBL· GenBank· DDBJ | mRNA | ||
AK223603 EMBL· GenBank· DDBJ | BAD97323.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AC115088 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC127035 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471064 EMBL· GenBank· DDBJ | EAW67985.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471064 EMBL· GenBank· DDBJ | EAW67986.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471064 EMBL· GenBank· DDBJ | EAW67987.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471064 EMBL· GenBank· DDBJ | EAW67988.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471064 EMBL· GenBank· DDBJ | EAW67989.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471064 EMBL· GenBank· DDBJ | EAW67990.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471064 EMBL· GenBank· DDBJ | EAW67991.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC001331 EMBL· GenBank· DDBJ | AAH01331.1 EMBL· GenBank· DDBJ | mRNA | ||
BC002378 EMBL· GenBank· DDBJ | AAH02378.1 EMBL· GenBank· DDBJ | mRNA | ||
BC006191 EMBL· GenBank· DDBJ | AAH06191.1 EMBL· GenBank· DDBJ | mRNA |