O73682 · VGFAA_DANRE
- ProteinVascular endothelial growth factor A-A
- Genevegfaa
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids188 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis, and induces permeabilization of blood vessels. Required for intersegmental vessel development in the tail during embryogenesis (PubMed:15305301).
Acts both upstream of kdr and tie1 to stimulate endothelial cell differentiation, and upstream of gata1 to stimulate hematopoietic cell differentiation
Acts both upstream of kdr and tie1 to stimulate endothelial cell differentiation, and upstream of gata1 to stimulate hematopoietic cell differentiation
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameVascular endothelial growth factor A-A
- Short namesVEGF-A-A
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionO73682
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Morpholino knockdowns show a complete loss of intersegmental vessels throughout the tail at 28 hpf.
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-23 | |||||
Sequence: MNLVVYLIQLFLAALLHLSAVKA | ||||||
Chain | PRO_0000023394 | 24-188 | Vascular endothelial growth factor A-A | |||
Sequence: AHIPKEGGKSKNDVIPFMDVYKKSACKTRELLVDIIQEYPDEIEHTYIPSCVVLMRCAGCCNDEALECVPTETRNVTMEVLRVKQRVSQHNFQLSFTEHTKCECRPKAEVKAKKENHCEPCSERRKRLYVQDPLTCKCSCKFTQMQCKSRQLELNERTCRCEKPR | ||||||
Disulfide bond | 49↔91 | |||||
Sequence: CKTRELLVDIIQEYPDEIEHTYIPSCVVLMRCAGCCNDEALEC | ||||||
Disulfide bond | 74 | Interchain | ||||
Sequence: C | ||||||
Disulfide bond | 80↔125 | |||||
Sequence: CAGCCNDEALECVPTETRNVTMEVLRVKQRVSQHNFQLSFTEHTKC | ||||||
Disulfide bond | 83 | Interchain | ||||
Sequence: C | ||||||
Disulfide bond | 84↔127 | |||||
Sequence: CNDEALECVPTETRNVTMEVLRVKQRVSQHNFQLSFTEHTKCEC | ||||||
Glycosylation | 98 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Predominantly expressed in regions associated with active vascularization. From 15-16 hours post-fertilization (hpf), expressed in the anterior forebrain, the mesoderm underlying and lateral to the anterior hindbrain, the mesoderm underlying and lateral to the posterior hindbrain, and in the ventral medial portions of the somites. By 30-36 hpf, expression in the somites is decreased, while strong expression is observed in the region of the developing glomeruli and in the anterior portion of the pronephric ducts, the pharyngeal arches, and the brain. By 72 hpf, expression remains only in the pronephros region.
Developmental stage
Expressed both maternally and zygotically. Present throughout embryonic development, and in adults.
Gene expression databases
Structure
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
O73682-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- NameVEGF165
- Length188
- Mass (Da)21,756
- Last updated1998-08-01 v1
- ChecksumFD203334EF365D1E
O73682-2
- NameVEGF121
- Differences from canonical
- 139-182: Missing
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8M3AHS3 | A0A8M3AHS3_DANRE | vegfaa | 207 |
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_050737 | 139-182 | in isoform VEGF121 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF016244 EMBL· GenBank· DDBJ | AAC41274.1 EMBL· GenBank· DDBJ | mRNA | ||
AF059661 EMBL· GenBank· DDBJ | AAC14713.1 EMBL· GenBank· DDBJ | mRNA | ||
BC162258 EMBL· GenBank· DDBJ | AAI62258.1 EMBL· GenBank· DDBJ | mRNA | ||
BC162588 EMBL· GenBank· DDBJ | AAI62588.1 EMBL· GenBank· DDBJ | mRNA |