O68690 · YSCG_YERPE
- ProteinType 3 secretion system chaperone YscG
- GeneyscG
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids115 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Chaperone of the type III secretion system (T3SS), also called injectisome, which is used to inject bacterial effector proteins into eukaryotic host cells (PubMed:18281060, PubMed:29458689).
Along with YscE, prevents premature polymerization of the YscF/SctF needle protein within the cytoplasm (By similarity).
Is also required for stable expression of cytosolic YscF and for YscF secretion (PubMed:29458689).
May act as a scaffold to organize the assembly of YscE and YscF into the heterotrimeric complex (PubMed:18281060).
Required for Yop secretion (PubMed:11035761).
Along with YscE, prevents premature polymerization of the YscF/SctF needle protein within the cytoplasm (By similarity).
Is also required for stable expression of cytosolic YscF and for YscF secretion (PubMed:29458689).
May act as a scaffold to organize the assembly of YscE and YscF into the heterotrimeric complex (PubMed:18281060).
Required for Yop secretion (PubMed:11035761).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm |
Names & Taxonomy
Protein names
- Recommended nameType 3 secretion system chaperone YscG
- Alternative names
Gene names
Encoded on
- Plasmid pCD1
- Plasmid unnamed1
Organism names
- Organism
- Strains
- Taxonomic lineageBacteria > Pseudomonadota > Gammaproteobacteria > Enterobacterales > Yersiniaceae > Yersinia
Accessions
- Primary accessionO68690
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Could be a peripheral membrane protein.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000458456 | 1-115 | Type 3 secretion system chaperone YscG | |||
Sequence: MKYKLNVLLAEIALIGTGNHYHEEANCIAEWLHLKGEEEAVQLIRLSSLMNRGDYASALQQGNKLAYPDLEPWLALCEYRLGLGSALESRLNRLARSQDPRIQTFVNGMREQLKT |
Proteomic databases
Interaction
Subunit
Component of the heterodimeric YscE-YscG chaperone (PubMed:11035761, PubMed:18281060, PubMed:29458689).
The YscE-YscG chaperone forms a stable ternary complex with YscF/SctF (PubMed:18281060).
YscG interacts with YscE and binds tightly to the C-terminal half of YscF (PubMed:11035761, PubMed:18281060).
The YscE-YscG chaperone forms a stable ternary complex with YscF/SctF (PubMed:18281060).
YscG interacts with YscE and binds tightly to the C-terminal half of YscF (PubMed:11035761, PubMed:18281060).
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Length115
- Mass (Da)13,070
- Last updated1998-08-01 v1
- Checksum6194CE122ED1AB4B
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF074612 EMBL· GenBank· DDBJ | AAC69777.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF053946 EMBL· GenBank· DDBJ | AAC62548.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
HQ612242 EMBL· GenBank· DDBJ | ADV16641.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL117189 EMBL· GenBank· DDBJ | CAB54933.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP033697 EMBL· GenBank· DDBJ | AYX17966.1 EMBL· GenBank· DDBJ | Genomic DNA |