O64750 · PSA2_ARATH
- ProteinProtein PHOTOSYSTEM I ASSEMBLY 2, chloroplastic
- GenePSA2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids186 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Involved in female gametophyte development. Required for embryo sac development (PubMed:15634699).
Nuclear genome-encoded factor required for the accumulation of photosystem I (PSI) during plant development (PubMed:25228689).
Required for light acclimation and chloroplast development (PubMed:27047527).
Nuclear genome-encoded factor required for the accumulation of photosystem I (PSI) during plant development (PubMed:25228689).
Required for light acclimation and chloroplast development (PubMed:27047527).
Cofactor
Note: Binds 2 Zn2+ ions per monomer.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 102 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 105 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 113 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 116 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 139 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 142 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 150 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 153 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | chloroplast thylakoid | |
Cellular Component | chloroplast thylakoid lumen | |
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | nucleus | |
Molecular Function | metal ion binding | |
Biological Process | megagametogenesis | |
Biological Process | photosystem I assembly | |
Biological Process | thylakoid membrane organization |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended nameProtein PHOTOSYSTEM I ASSEMBLY 2, chloroplastic
- Short namesAtPSA2
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionO64750
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Embryonic lethality due to female gametophyte development arrest at two-nuclear stage (PubMed:15634699).
Seedling lethality when homozygous. Pale green leaf, variegated leaf and slow growing phenotype when grown on MS medium supplemented with sucrose (PubMed:25228689, PubMed:27047527).
Seedling lethality when homozygous. Pale green leaf, variegated leaf and slow growing phenotype when grown on MS medium supplemented with sucrose (PubMed:25228689, PubMed:27047527).
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 12 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-75 | Chloroplast | ||||
Sequence: MAASSSHLFALPSPASPFLSAPNRNRVRVLAKSCPENQSFDSNDSDSSSETTHKAQGDQKSVSRRQWMTACVCAS | ||||||
Chain | PRO_0000434572 | 76-186 | Protein PHOTOSYSTEM I ASSEMBLY 2, chloroplastic | |||
Sequence: AALISNSYTFVSVQSAAALDKKPGGSCRNCQGSGAVLCDMCGGTGKWKALNRKRAKDVYEFTECPNCYGRGKLVCPVCLGTGLPNNKGLLRRPGARELLEKMYNGRLLPDS |
Proteomic databases
Expression
Tissue specificity
Expressed in leaves and flowers. Expressed at low levels in siliques.
Gene expression databases
Interaction
Structure
Family & Domains
Features
Showing features for region, zinc finger, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-22 | Disordered | ||||
Sequence: MAASSSHLFALPSPASPFLSAP | ||||||
Region | 35-60 | Disordered | ||||
Sequence: PENQSFDSNDSDSSSETTHKAQGDQK | ||||||
Zinc finger | 81-162 | CR-type | ||||
Sequence: NSYTFVSVQSAAALDKKPGGSCRNCQGSGAVLCDMCGGTGKWKALNRKRAKDVYEFTECPNCYGRGKLVCPVCLGTGLPNNK | ||||||
Repeat | 102-109 | CXXCXGXG motif | ||||
Sequence: CRNCQGSG | ||||||
Repeat | 113-120 | CXXCXGXG motif | ||||
Sequence: CDMCGGTG | ||||||
Repeat | 139-146 | CXXCXGXG motif | ||||
Sequence: CPNCYGRG | ||||||
Repeat | 150-157 | CXXCXGXG motif | ||||
Sequence: CPVCLGTG |
Sequence similarities
Belongs to the DnaJ family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length186
- Mass (Da)19,943
- Last updated1998-08-01 v1
- Checksum86BD8981B3E6E603
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC004238 EMBL· GenBank· DDBJ | AAC12826.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC09031.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC09032.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY099664 EMBL· GenBank· DDBJ | AAM20515.1 EMBL· GenBank· DDBJ | mRNA | ||
AY128851 EMBL· GenBank· DDBJ | AAM91251.1 EMBL· GenBank· DDBJ | mRNA |