O62618 · MK38A_DROME
- ProteinMitogen-activated protein kinase p38a
- Genep38a
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids366 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Kinase involved in a signal transduction pathway. May down-regulate insect immunity gene expression after prolonged infection.
Catalytic activity
- ATP + L-seryl-[protein] = ADP + H+ + O-phospho-L-seryl-[protein]
Cofactor
Activity regulation
Activated by threonine and tyrosine phosphorylation by Mkk3 in response to environmental stress.
Features
Showing features for binding site, active site.
GO annotations
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameMitogen-activated protein kinase p38a
- EC number
- Short namesMAP kinase p38a ; MAPK p38a
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionO62618
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000186300 | 1-366 | Mitogen-activated protein kinase p38a | |||
Sequence: MSVSITKKFYKLDINRTEWEIPDIYQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYRELRLLKHMDHENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNIIRMQHLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTENEMTGYVATRWYRAPEIMLNWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESARSYIQSLPPMKGRSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYLEKYAEPSVEQTSPPYDHSFEDMDLPVDKWKELIYKEVTNFKPPPSYAQVLKDVK | ||||||
Modified residue | 184 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 186 | Phosphotyrosine | ||||
Sequence: Y |
Post-translational modification
Dually phosphorylated on Thr-184 and Tyr-186, which activates the enzyme.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Developmental stage
Expressed both maternally and zygotically. Levels are highest at the preblastoderm stage but low levels are present throughout development.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 25-312 | Protein kinase | ||||
Sequence: YQDLQPVGSGAYGQVSKAVVRGTNMHVAIKKLARPFQSAVHAKRTYRELRLLKHMDHENVIGLLDIFHPHPANGSLENFQQVYLVTHLMDADLNNIIRMQHLSDDHVQFLVYQILRGLKYIHSAGVIHRDLKPSNIAVNEDCELRILDFGLARPTENEMTGYVATRWYRAPEIMLNWMHYDQTVDIWSVGCIMAELITRRTLFPGTDHIHQLNLIMEMLGTPPAEFLKKISSESARSYIQSLPPMKGRSFKNVFKNANPLAIDLLEKMLELDAEKRITAEEALSHPYL | ||||||
Motif | 184-186 | TXY | ||||
Sequence: TGY |
Domain
The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
Sequence similarities
Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length366
- Mass (Da)42,256
- Last updated1998-08-01 v1
- ChecksumB3592B869F97990E
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
E1JIV6 | E1JIV6_DROME | p38a | 366 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 27 | in Ref. 2; AAB97138 | ||||
Sequence: D → G | ||||||
Sequence conflict | 77 | in Ref. 6 | ||||
Sequence: K → R | ||||||
Sequence conflict | 80 | in Ref. 2; AAB97138 | ||||
Sequence: D → A | ||||||
Sequence conflict | 108 | in Ref. 6 | ||||
Sequence: L → LL | ||||||
Sequence conflict | 124 | in Ref. 6 | ||||
Sequence: Q → QQ | ||||||
Sequence conflict | 149 | in Ref. 6 | ||||
Sequence: Missing | ||||||
Sequence conflict | 163 | in Ref. 6 | ||||
Sequence: N → NN |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U86867 EMBL· GenBank· DDBJ | AAB97138.1 EMBL· GenBank· DDBJ | mRNA | ||
AF035546 EMBL· GenBank· DDBJ | AAC39030.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF035547 EMBL· GenBank· DDBJ | AAC39031.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014297 EMBL· GenBank· DDBJ | AAF56244.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AE014297 EMBL· GenBank· DDBJ | AAN13984.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY071670 EMBL· GenBank· DDBJ | AAL49292.1 EMBL· GenBank· DDBJ | mRNA |