O61493 · HOOK_DROVI
- ProteinProtein hook
- Genehook
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids678 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
Involved in endocytic trafficking by stabilizing organelles of the endocytic pathway. Probably acts as a cytoskeletal linker protein required to tether endosome vesicles to the cytoskeleton. Involved in modulation of endocytosis at stages required for down-regulation of membrane proteins that control synapse size. Not involved in synaptic vesicle recycling. Required in R7 cells for boss endocytosis into multivesicular bodies (MVBs). Has a role in regulating adult longevity.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | centrosome | |
Cellular Component | endosome | |
Cellular Component | microtubule | |
Cellular Component | synapse | |
Molecular Function | dynein light intermediate chain binding | |
Molecular Function | microtubule binding | |
Biological Process | cytoplasmic microtubule organization | |
Biological Process | cytoskeleton-dependent intracellular transport | |
Biological Process | endocytosis |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameProtein hook
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila
Accessions
- Primary accessionO61493
- Secondary accessions
Proteomes
Subcellular Location
UniProt Annotation
GO Annotation
Note: Enriched at neuromuscular synapses, in both presynaptic and postsynaptic regions.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000219200 | 1-678 | Protein hook | |||
Sequence: MSTQNGMYYSLLEWFKTLNLNAPHANAEELADGVALAQALNQFAPESFTNSWLSKIKSSAVGGNWRLRMSNLKKVVEGVYEYYSDVLNYTLQHDFVKPDVQAIAEKCDLSELERLLQLVLGCAVNCAKKQSYICEIMCLEEELQANIMRALQELESSTRQTTEGGVVSSLSRNSLSGMLDGNAKALEERDAMAQKCFETEKKMLLLIDEKTNLQQELHKLQLEFARLEHNTIGDDGVSLGPIQAGSVRYNELRRQLELVKEELLQSEGAREDLKIKAQQQETDLLHMQQRIDELMKSTAELTALKDEVDVLRESTDKLKVCEAQLETYKKKLEEYNDLKKHVKMLEERSADYVQQNAQFEEDAKRYANTKGQVELFKKEIQDLHAQLDNESSKNVKLEFDNKNLESKTLALQREKDNLLKERDNLREAFDELKCGQLSTNSGSLTGTTMSRELQPPAMMDKMQRLEAENKALREGQGGQTALAQLLDDANKRCEHLREQLKTANERILSLSHASQSDDPILKENEFSKQIKQLMELNEQKTLQIEESATQNSTMQCKITQLESTLATREQELMAYEVKYRKCIERAKEVIKNIDPRIASVMEANNLEKSVDVIEEESKTKMSGMEEQLMASAFYRLGVNAQRDAVDSKLALLMGSGQTFLARQRQSAPRKPLTTMKSK |
Interaction
Subunit
Homodimer. Interacts with microtubules via its N-terminus.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, domain, coiled coil.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-155 | Interaction with microtubules | ||||
Sequence: MSTQNGMYYSLLEWFKTLNLNAPHANAEELADGVALAQALNQFAPESFTNSWLSKIKSSAVGGNWRLRMSNLKKVVEGVYEYYSDVLNYTLQHDFVKPDVQAIAEKCDLSELERLLQLVLGCAVNCAKKQSYICEIMCLEEELQANIMRALQELE | ||||||
Domain | 5-123 | Calponin-homology (CH) | ||||
Sequence: NGMYYSLLEWFKTLNLNAPHANAEELADGVALAQALNQFAPESFTNSWLSKIKSSAVGGNWRLRMSNLKKVVEGVYEYYSDVLNYTLQHDFVKPDVQAIAEKCDLSELERLLQLVLGCA | ||||||
Coiled coil | 135-435 | |||||
Sequence: EIMCLEEELQANIMRALQELESSTRQTTEGGVVSSLSRNSLSGMLDGNAKALEERDAMAQKCFETEKKMLLLIDEKTNLQQELHKLQLEFARLEHNTIGDDGVSLGPIQAGSVRYNELRRQLELVKEELLQSEGAREDLKIKAQQQETDLLHMQQRIDELMKSTAELTALKDEVDVLRESTDKLKVCEAQLETYKKKLEEYNDLKKHVKMLEERSADYVQQNAQFEEDAKRYANTKGQVELFKKEIQDLHAQLDNESSKNVKLEFDNKNLESKTLALQREKDNLLKERDNLREAFDELKCG | ||||||
Coiled coil | 479-589 | |||||
Sequence: QTALAQLLDDANKRCEHLREQLKTANERILSLSHASQSDDPILKENEFSKQIKQLMELNEQKTLQIEESATQNSTMQCKITQLESTLATREQELMAYEVKYRKCIERAKEV |
Domain
The coiled coil domain mediates homodimerization.
Sequence similarities
Belongs to the hook family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length678
- Mass (Da)77,199
- Last updated1998-08-01 v1
- Checksum1B8535E80F06C673
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF044926 EMBL· GenBank· DDBJ | AAC09301.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH940649 EMBL· GenBank· DDBJ | EDW63699.1 EMBL· GenBank· DDBJ | Genomic DNA |