O60613 · SEP15_HUMAN
- ProteinSelenoprotein F
- GeneSELENOF
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids165 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
May be involved in redox reactions associated with the formation of disulfide bonds (By similarity).
May contribute to the quality control of protein folding in the endoplasmic reticulum (PubMed:24415556).
May regulate protein folding by enhancing the catalytic activity of UGGT1/UGCGL1 and UGGT2/UGCGL2 (PubMed:24415556).
May contribute to the quality control of protein folding in the endoplasmic reticulum (PubMed:24415556).
May regulate protein folding by enhancing the catalytic activity of UGGT1/UGCGL1 and UGGT2/UGCGL2 (PubMed:24415556).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum lumen | |
Molecular Function | oxidoreductase activity | |
Molecular Function | selenium binding | |
Molecular Function | thioredoxin peroxidase activity | |
Biological Process | 'de novo' post-translational protein folding | |
Biological Process | sperm DNA condensation |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSelenoprotein F
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO60613
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: The association with UGGT1/UGCGL1 is essential for its retention in the endoplasmic reticulum.
Keywords
- Cellular component
Disease & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 96 | Does not affect protein folding and binding to UGGT1 or UGGT2. | ||||
Sequence: U → C |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 189 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Signal | 1-31 | UniProt | |||||
Sequence: MVAMAAGPSGCLVPAFGLRLLLATVLQAVSA | |||||||
Chain | PRO_0000022307 | 32-165 | UniProt | Selenoprotein F | |||
Sequence: FGAEFSSEACRELGFSSNLLCSSCDLLGQFNLLQLDPDCRGCCQEEAQFETKKLYAGAILEVCGUKLGRFPQVQAFVRSDKPKLFRGLQIKYVRGSDPVLKLLDDNGNIAEELSILKWNTDSVEEFLSEKLERI | |||||||
Modified residue (large scale data) | 153 | PRIDE | Phosphoserine | ||||
Sequence: S |
Post-translational modification
The N-terminus is blocked.
Proteomic databases
PTM databases
Expression
Tissue specificity
Higher levels in prostate and thyroid gland.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Forms a tight complex with UGGT1/UGCGL1 (PubMed:24415556).
Interacts with UGGT2/UGCGL2 (PubMed:24415556).
Interacts with RDH11 (PubMed:29410696).
Interacts with UGGT2/UGCGL2 (PubMed:24415556).
Interacts with RDH11 (PubMed:29410696).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O60613 | RDH11 Q8TC12 | 5 | EBI-1052797, EBI-2823756 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
O60613-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length165
- Mass (Da)18,092
- Last updated2018-03-28 v4
- ChecksumE20C44FAB97AD336
O60613-2
- Name2
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A8MZD0 | A8MZD0_HUMAN | SELENOF | 144 | ||
A0A0J9YX89 | A0A0J9YX89_HUMAN | SELENOF | 88 | ||
A0A0J9YXM9 | A0A0J9YXM9_HUMAN | SELENOF | 31 | ||
A0A3B3IT39 | A0A3B3IT39_HUMAN | SELENOF | 126 |
Sequence caution
Features
Showing features for non-standard residue, alternative sequence.
Mass Spectrometry
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF288991 EMBL· GenBank· DDBJ | AAG31556.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AF288992 EMBL· GenBank· DDBJ | AAG31557.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
AF267982 EMBL· GenBank· DDBJ | AAF78966.1 EMBL· GenBank· DDBJ | Genomic DNA | Different initiation | |
AL833575 EMBL· GenBank· DDBJ | CAJ18323.1 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AL121989 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC005294 EMBL· GenBank· DDBJ | AAH05294.3 EMBL· GenBank· DDBJ | mRNA | ||
BC016359 EMBL· GenBank· DDBJ | AAH16359.3 EMBL· GenBank· DDBJ | mRNA | ||
BC021697 EMBL· GenBank· DDBJ | AAH21697.3 EMBL· GenBank· DDBJ | mRNA | ||
AF051894 EMBL· GenBank· DDBJ | AAC15478.1 EMBL· GenBank· DDBJ | mRNA | Different initiation |