O57606 · THA_NECMA
- ProteinThyroid hormone receptor alpha
- GeneTHRA
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids408 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Nuclear hormone receptor that can act as a repressor or activator of transcription. High affinity receptor for thyroid hormones, including triiodothyronine and thyroxine.
Features
Showing features for dna binding, binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 48-125 | Nuclear receptor | ||||
Sequence: DEPCVVCSDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYDACCIIDKITRNQCQLCRFKKCIAVGMAMDLVLD | ||||||
Binding site | 51 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 54 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 68 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 71 | Zn2+ 1 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 89 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 95 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 105 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 108 | Zn2+ 2 (UniProtKB | ChEBI) | ||||
Sequence: C | ||||||
Binding site | 226 | 3,3',5-triiodo-L-thyronine (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 275 | 3,3',5-triiodo-L-thyronine (UniProtKB | ChEBI) | ||||
Sequence: S |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | nuclear receptor activity | |
Molecular Function | sequence-specific DNA binding | |
Molecular Function | thyroid hormone binding | |
Molecular Function | zinc ion binding |
Keywords
- Molecular function
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameThyroid hormone receptor alpha
- Alternative names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Amphibia > Batrachia > Caudata > Salamandroidea > Proteidae > Necturus
Accessions
- Primary accessionO57606
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000053441 | 1-408 | Thyroid hormone receptor alpha | |||
Sequence: MDQNLSDLDCLSDPDEKRWLDGKRKRKNSQCLLKNSMSGYIPSYLDKDEPCVVCSDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYDACCIIDKITRNQCQLCRFKKCIAVGMAMDLVLDDSKRVAKRKLIEENRERRRKEEMLKSMQNRPEPTSEEWELIRLVTDAHCSTNAQGSHWKQKRKFLPDAIGQCPMTAVPENDRVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLSGEMAVKREQLKNGGLGVVSDAIFDLGKSLSAFNLDDTEVALLQAVLLMSSDRSGLTCMDKVEKCQETYLLAFEHYINHRKHHIPHFWPKLLMKVTDLRMIGACHASRFMHMKVECPTELFPPLFLEVFEDQEV |
Expression
Tissue specificity
A high level expression seen in the gills, intestine and muscles.
Structure
Family & Domains
Features
Showing features for region, zinc finger, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-50 | Modulating | ||||
Sequence: MDQNLSDLDCLSDPDEKRWLDGKRKRKNSQCLLKNSMSGYIPSYLDKDEP | ||||||
Zinc finger | 51-71 | NR C4-type | ||||
Sequence: CVVCSDKATGYHYRCITCEGC | ||||||
Zinc finger | 89-113 | NR C4-type | ||||
Sequence: CKYDACCIIDKITRNQCQLCRFKKC | ||||||
Domain | 161-405 | NR LBD | ||||
Sequence: EEWELIRLVTDAHCSTNAQGSHWKQKRKFLPDAIGQCPMTAVPENDRVDLEAFSEFTKIITPAITRVVDFAKKLPMFSELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLSGEMAVKREQLKNGGLGVVSDAIFDLGKSLSAFNLDDTEVALLQAVLLMSSDRSGLTCMDKVEKCQETYLLAFEHYINHRKHHIPHFWPKLLMKVTDLRMIGACHASRFMHMKVECPTELFPPLFLEVFED |
Domain
Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain.
Sequence similarities
Belongs to the nuclear hormone receptor family. NR1 subfamily.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusComplete
- Length408
- Mass (Da)46,922
- Last updated2005-01-04 v2
- ChecksumF5A1A2272595AE9E