O55176 · PJA1_MOUSE
- ProteinE3 ubiquitin-protein ligase Praja-1
- GenePja1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids578 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Has E2-dependent E3 ubiquitin-protein ligase activity. Ubiquitinates MAGED1 antigen leading to its subsequent degradation by proteasome. May be involved in protein sorting.
Catalytic activity
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | metal ion binding | |
Molecular Function | ubiquitin protein ligase activity | |
Biological Process | protein catabolic process |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameE3 ubiquitin-protein ligase Praja-1
- EC number
- Short namesPraja1
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionO55176
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 533 | No effect on MAGED1 binding. Decrease in ubiquitination of MAGED1. No inhibition of DLX5-dependent transcriptional activity. | ||||
Sequence: C → A | ||||||
Mutagenesis | 553 | Loss of ubiquitination activity. | ||||
Sequence: H → S |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 64 variants from UniProt as well as other sources including ClinVar and dbSNP.
Chemistry
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000056000 | 1-578 | E3 ubiquitin-protein ligase Praja-1 | |||
Sequence: MSHQERIASQRRTTAEVPMHRSTANQSKRSRSPFASTRRRWDDSESSGASLAVESEDYSRYPPREYRASGSRRGLAYGHIDTVVARDSEEEGAGPVDRLPVRGKAGKFKDDPEKGARSSRFTSVNHDAKEECGKVESPPAARCSARRAELSKQNGSSASQISSAEGRAAAKGNNSLERERQNLPARPSRAPVSICGGGENTPKSAEEPVVRPKVRNVATPNCMKPKVFFDTDDDDDVPHSTSRWRDAADAEEAHAEGLARRGRGEAASSSEPRYAEDQDARSEQAKADKVPRRRRTMADPDFWAYTDDYYRYYEEDSDSDKEWMAALRRKYRSREQPQSSSGESWELLPGKEELERQQAGAGSLASAGSNGSGYPEEVQDPSLQEEEQASLEEGEIPWLRYNENESSSEGDNESTHELIQPGMFMLDGNNNLEDDSSVSEDLEVDWSLFDGFADGLGVAEAISYVDPQFLTYMALEERLAQAMETALAHLESLAVDVEVANPPASKESIDALPEILVTEDHGAVGQEMCCPICCSEYVKGEVATELPCHHYFHKPCVSIWLQKSGTCPVCRCMFPPPL | ||||||
Modified residue | 231 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 317 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 319 | Phosphoserine | ||||
Sequence: S |
Post-translational modification
Substrate for E2-dependent ubiquitination.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in brain, liver, kidney. Highest levels in brain where it is found in many regions including cortical and subcortical areas and in neurons of the amygdala. Weak expression also found in testis. Also expressed in developing embryo.
Induction
By fear memory. Differential induction of isoforms.
Gene expression databases
Interaction
Subunit
Binds ubiquitin-conjugating enzymes (E2s). Binds, in vitro and in vivo, the MAGE conserved domain of MAGED1. Binds weakly Necdin, in vitro. Interacts with UBE2D2.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O55176-2 | Maged1 Q9QYH6 | 2 | EBI-1801670, EBI-1801274 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-298 | Disordered | ||||
Sequence: MSHQERIASQRRTTAEVPMHRSTANQSKRSRSPFASTRRRWDDSESSGASLAVESEDYSRYPPREYRASGSRRGLAYGHIDTVVARDSEEEGAGPVDRLPVRGKAGKFKDDPEKGARSSRFTSVNHDAKEECGKVESPPAARCSARRAELSKQNGSSASQISSAEGRAAAKGNNSLERERQNLPARPSRAPVSICGGGENTPKSAEEPVVRPKVRNVATPNCMKPKVFFDTDDDDDVPHSTSRWRDAADAEEAHAEGLARRGRGEAASSSEPRYAEDQDARSEQAKADKVPRRRRTMA | ||||||
Compositional bias | 15-32 | Polar residues | ||||
Sequence: AEVPMHRSTANQSKRSRS | ||||||
Compositional bias | 83-117 | Basic and acidic residues | ||||
Sequence: VVARDSEEEGAGPVDRLPVRGKAGKFKDDPEKGAR | ||||||
Compositional bias | 149-181 | Polar residues | ||||
Sequence: ELSKQNGSSASQISSAEGRAAAKGNNSLERERQ | ||||||
Compositional bias | 227-298 | Basic and acidic residues | ||||
Sequence: VFFDTDDDDDVPHSTSRWRDAADAEEAHAEGLARRGRGEAASSSEPRYAEDQDARSEQAKADKVPRRRRTMA | ||||||
Region | 332-397 | Disordered | ||||
Sequence: RSREQPQSSSGESWELLPGKEELERQQAGAGSLASAGSNGSGYPEEVQDPSLQEEEQASLEEGEIP | ||||||
Compositional bias | 362-377 | Polar residues | ||||
Sequence: GSLASAGSNGSGYPEE | ||||||
Zinc finger | 530-571 | RING-type | ||||
Sequence: CPICCSEYVKGEVATELPCHHYFHKPCVSIWLQKSGTCPVCR |
Domain
The RING-type zinc finger domain interacts with an ubiquitin-conjugating enzyme (E2) and facilitates ubiquitination.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 4 isoforms produced by Alternative splicing. Alternative splicing appears to be tissue-specific.
O55176-3
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsPraja1a
- Length578
- Mass (Da)63,906
- Last updated2006-12-12 v3
- Checksum11B2D3C1F8982143
O55176-2
- Name2
- Differences from canonical
- 60-243: Missing
O55176-4
- Name3
- SynonymsPraja1c
- Differences from canonical
- 197-411: Missing
O55176-5
- Name4
- SynonymsPraja1d
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Features
Showing features for compositional bias, alternative sequence, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 15-32 | Polar residues | ||||
Sequence: AEVPMHRSTANQSKRSRS | ||||||
Alternative sequence | VSP_007519 | 60-243 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 83-117 | Basic and acidic residues | ||||
Sequence: VVARDSEEEGAGPVDRLPVRGKAGKFKDDPEKGAR | ||||||
Compositional bias | 149-181 | Polar residues | ||||
Sequence: ELSKQNGSSASQISSAEGRAAAKGNNSLERERQ | ||||||
Alternative sequence | VSP_022011 | 185-187 | in isoform 4 | |||
Sequence: ARP → PLF | ||||||
Alternative sequence | VSP_007520 | 188-578 | in isoform 4 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_007521 | 197-411 | in isoform 3 | |||
Sequence: Missing | ||||||
Compositional bias | 227-298 | Basic and acidic residues | ||||
Sequence: VFFDTDDDDDVPHSTSRWRDAADAEEAHAEGLARRGRGEAASSSEPRYAEDQDARSEQAKADKVPRRRRTMA | ||||||
Sequence conflict | 236 | in Ref. 3; AAK15764 | ||||
Sequence: D → DD | ||||||
Compositional bias | 362-377 | Polar residues | ||||
Sequence: GSLASAGSNGSGYPEE | ||||||
Sequence conflict | 515 | in Ref. 5; BAB23982 | ||||
Sequence: I → M | ||||||
Sequence conflict | 523 | in Ref. 3; AAK15764/AAK15765 | ||||
Sequence: A → T |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U06944 EMBL· GenBank· DDBJ | AAC00205.2 EMBL· GenBank· DDBJ | mRNA | ||
AF335250 EMBL· GenBank· DDBJ | AAK15764.2 EMBL· GenBank· DDBJ | mRNA | ||
AF335251 EMBL· GenBank· DDBJ | AAK15765.2 EMBL· GenBank· DDBJ | mRNA | ||
AF335252 EMBL· GenBank· DDBJ | AAK15766.1 EMBL· GenBank· DDBJ | mRNA | ||
AK005373 EMBL· GenBank· DDBJ | BAB23982.1 EMBL· GenBank· DDBJ | mRNA | ||
BC037616 EMBL· GenBank· DDBJ | AAH37616.1 EMBL· GenBank· DDBJ | mRNA |