O50039 · OTC_ARATH
- ProteinOrnithine transcarbamylase, chloroplastic
- GeneOTC
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids375 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
Catalytic activity
- carbamoyl phosphate + L-ornithine = H+ + L-citrulline + phosphate
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 123-126 | carbamoyl phosphate (UniProtKB | ChEBI) | ||||
Sequence: SMRT | ||||||
Binding site | 174 | carbamoyl phosphate (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 201 | carbamoyl phosphate (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 204 | carbamoyl phosphate (UniProtKB | ChEBI) | ||||
Sequence: Q | ||||||
Binding site | 232 | L-ornithine (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 293 | L-ornithine (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 297 | L-ornithine (UniProtKB | ChEBI) | ||||
Sequence: S | ||||||
Binding site | 298 | L-ornithine (UniProtKB | ChEBI) | ||||
Sequence: M | ||||||
Active site | 333 | Proton acceptor | ||||
Sequence: C | ||||||
Binding site | 333-334 | carbamoyl phosphate (UniProtKB | ChEBI) | ||||
Sequence: CL | ||||||
Binding site | 361 | carbamoyl phosphate (UniProtKB | ChEBI) | ||||
Sequence: R |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | chloroplast stroma | |
Molecular Function | amino acid binding | |
Molecular Function | ornithine carbamoyltransferase activity | |
Biological Process | arginine biosynthetic process |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameOrnithine transcarbamylase, chloroplastic
- EC number
- Short namesOTCase
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionO50039
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for transit peptide, modified residue, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-53 | Chloroplast | ||||
Sequence: MAAAMASHVSTARSPALSFSSSSSSFFPGTTLRRFSAVSLPSPALPRLRVSCQ | ||||||
Modified residue | 54 | N-acetylalanine | ||||
Sequence: A | ||||||
Chain | PRO_0000020340 | 54-375 | Ornithine transcarbamylase, chloroplastic | |||
Sequence: ASSVTSPSSPSDVKGKSDLKDFLAIDDFDTATIKTILDKASEVKALLKSGERNYLPFKGKSMSMIFAKPSMRTRVSFETGFFLLGGHALYLGPNDIQMGKREETRDVARVLSRYNDIIMARVFAHQDILDLANYSSVPVVNGLTDHNHPCQIMADALTMIEHIGQVEGTKVVYVGDGNNMVHSWLELASVIPFHFVCACPKGYEPDKERVSKAKQAGLSKIEITNDPKEAVIGADVVYSDVWASMGQKDEAEARRKAFQGFQVDEALMKLAGQKAYFMHCLPAERGVEVTNGVVEAPYSIVFPQAENRMHAQNAIMLHLLGF |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length375
- Mass (Da)41,002
- Last updated2001-07-11 v2
- Checksum9DA2A0B512FCA323
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 158 | in Ref. 1; CAA04115/CAA05510 | ||||
Sequence: R → P | ||||||
Sequence conflict | 214 | in Ref. 1; CAA04115/CAA05510 | ||||
Sequence: E → K | ||||||
Sequence conflict | 219-222 | in Ref. 1; CAA04115/CAA05510 | ||||
Sequence: VEGT → FERK | ||||||
Sequence conflict | 366 | in Ref. 1; CAA04115/CAA05510 | ||||
Sequence: N → Y |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ000476 EMBL· GenBank· DDBJ | CAA04115.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ002524 EMBL· GenBank· DDBJ | CAA05510.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC023754 EMBL· GenBank· DDBJ | AAG13075.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE35701.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF370270 EMBL· GenBank· DDBJ | AAK44085.1 EMBL· GenBank· DDBJ | mRNA | ||
AY063030 EMBL· GenBank· DDBJ | AAL34204.1 EMBL· GenBank· DDBJ | mRNA |