O49613 · HIP25_ARATH
- ProteinHeavy metal-associated isoprenylated plant protein 25
- GeneHIPP25
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids153 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Heavy-metal-binding protein. Binds cadmium. May be involved in cadmium transport and play a role in cadmium detoxification.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | membrane | |
Cellular Component | plasmodesma | |
Molecular Function | metal ion binding |
Keywords
- Ligand
Names & Taxonomy
Protein names
- Recommended nameHeavy metal-associated isoprenylated plant protein 25
- Short namesAtHIP25 ; AtHIPP25
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionO49613
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, modified residue, lipidation, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000435861 | 1-150 | Heavy metal-associated isoprenylated plant protein 25 | |||
Sequence: MGVLDHVSEYFDCSHGSSKRHKSLQTVDVRVLIDCEGCERKVRRALEGMRGIRDVTIEPNAQKVTVVGYVEPNKVVARIIHRTGKRAELYPFVPYDVVAHPYASGVYDNRAPTGYVRNTEYDPHVSRLARASSTEVRYTTAFSDENASAC | ||||||
Modified residue | 150 | Cysteine methyl ester | ||||
Sequence: C | ||||||
Lipidation | 150 | S-farnesyl cysteine | ||||
Sequence: C | ||||||
Propeptide | PRO_0000435862 | 151-153 | Removed in mature form | |||
Sequence: VVM |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in roots, shoot apical meristem, trichomes and flower buds.
Gene expression databases
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 24-88 | HMA | ||||
Sequence: LQTVDVRVLIDCEGCERKVRRALEGMRGIRDVTIEPNAQKVTVVGYVEPNKVVARIIHRTGKRAE |
Sequence similarities
Belongs to the HIPP family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length153
- Mass (Da)17,162
- Last updated1998-06-01 v1
- ChecksumB25C8CAAC94A3BE0
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 118 | in Ref. 4; BAF00942 | ||||
Sequence: N → S |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AL022023 EMBL· GenBank· DDBJ | CAA17771.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL161586 EMBL· GenBank· DDBJ | CAB80223.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002687 EMBL· GenBank· DDBJ | AEE86456.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT024822 EMBL· GenBank· DDBJ | ABD60705.1 EMBL· GenBank· DDBJ | mRNA | ||
AK229060 EMBL· GenBank· DDBJ | BAF00942.1 EMBL· GenBank· DDBJ | mRNA | ||
AY086639 EMBL· GenBank· DDBJ | AAM63697.1 EMBL· GenBank· DDBJ | mRNA |