O49344 · PSBP2_ARATH
- ProteinPutative oxygen-evolving enhancer protein 2-2
- GenePSBP2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids125 (go to sequence)
- Protein existenceUncertain
- Annotation score3/5
Function
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | chloroplast stroma | |
Cellular Component | chloroplast thylakoid | |
Cellular Component | chloroplast thylakoid lumen | |
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | extrinsic component of membrane | |
Cellular Component | peroxisome | |
Cellular Component | photosystem II oxygen evolving complex | |
Cellular Component | thylakoid | |
Cellular Component | thylakoid lumen | |
Molecular Function | calcium ion binding | |
Biological Process | photosynthesis |
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended namePutative oxygen-evolving enhancer protein 2-2
- Short namesOEE2
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionO49344
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000029572 | 1-125 | Putative oxygen-evolving enhancer protein 2-2 | |||
Sequence: MITPTDKKSITDYGSPEQFLSQVNYLLGKQAYVGETASEGGFDANAVATANILETSTQEIGGKEYYYLSVLTRTADGDEGGKHQLITATVNGGKLYICKAQAGDKRWFKGARKFVENAATSFSVA | ||||||
Modified residue | 15 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
Expression
Gene expression databases
Structure
Sequence
- Sequence statusComplete
- Length125
- Mass (Da)13,443
- Last updated2008-06-10 v3
- Checksum27FE818F8F86D7C6
Sequence caution
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC002340 EMBL· GenBank· DDBJ | AAC02750.1 EMBL· GenBank· DDBJ | Genomic DNA | Sequence problems. | |
CP002685 EMBL· GenBank· DDBJ | AEC08441.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT015608 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
BT022094 EMBL· GenBank· DDBJ | AAY34155.1 EMBL· GenBank· DDBJ | mRNA | ||
AK175738 EMBL· GenBank· DDBJ | BAD43501.1 EMBL· GenBank· DDBJ | mRNA | ||
AK175821 EMBL· GenBank· DDBJ | BAD43584.1 EMBL· GenBank· DDBJ | mRNA | ||
AK175934 EMBL· GenBank· DDBJ | BAD43697.1 EMBL· GenBank· DDBJ | mRNA |