O46132 · O46132_LOCMI
- ProteinNicotinic acetylcholine receptor, alpha1 subunit
- GenenAChR
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids559 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | neuron projection | |
Cellular Component | postsynaptic membrane | |
Molecular Function | acetylcholine-gated monoatomic cation-selective channel activity | |
Molecular Function | transmembrane signaling receptor activity |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Submitted names
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Polyneoptera > Orthoptera > Caelifera > Acrididea > Acridomorpha > Acridoidea > Acrididae > Oedipodinae > Locusta
Accessions
- Primary accessionO46132
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Multi-pass membrane protein
Membrane ; Multi-pass membrane protein
Postsynaptic cell membrane ; Multi-pass membrane protein
Synaptic cell membrane ; Multi-pass membrane protein
Features
Showing features for transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transmembrane | 201-224 | Helical | ||||
Sequence: LFYTVNIIIPCMGISFLTVLTFYL | ||||||
Transmembrane | 236-254 | Helical | ||||
Sequence: ISILISLHVFFLLVVEIIP | ||||||
Transmembrane | 266-287 | Helical | ||||
Sequence: YLIFAMILVSISICVTVVVLNV | ||||||
Transmembrane | 511-531 | Helical | ||||
Sequence: LFLWIFTLAVLVGTAGIILQA |
Keywords
- Cellular component
PTM/Processing
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-200 | Neurotransmitter-gated ion-channel ligand-binding | ||||
Sequence: RPVTNNSYRLTVKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHVPSEHIWLPDIVLTNNSEGNFEVTLATKATIYHQGLVEWKPPAIYKSSCEIDVEYFPFDEQTCVLKFGSWTYDGFKVDLRHMDEQAGSNVVEVGVDLSEFYMSVEWDILEVPAVRNEKFYTCCDEPYLDITFNITMRRKT | ||||||
Domain | 207-527 | Neurotransmitter-gated ion-channel transmembrane | ||||
Sequence: IIIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFLLVVEIIPPTSLVVPLLPKYLIFAMILVSISICVTVVVLNVHFRSPQMHKMAPWVKRVFIHILPRLLVMRRPQYQFEATRFACGRVLVRPLGALRKEGVGVGVGPAHACFYPYQERGLRRRPGRGRRGRRAGAPQGLLQRQPAHAHLQGRPLARQPAGRRAAGGQLPGARAAGRGAGGGAAVGRGGGVQEPATAAAAATASGPGAPVAPAGRVRSPPAFPHSRCPPEVHRSCFCVRFIAEHTRMLEDSTKVKEDWKYVAMVLDRLFLWIFTLAVLVGTAGI | ||||||
Region | 365-467 | Disordered | ||||
Sequence: RRRPGRGRRGRRAGAPQGLLQRQPAHAHLQGRPLARQPAGRRAAGGQLPGARAAGRGAGGGAAVGRGGGVQEPATAAAAATASGPGAPVAPAGRVRSPPAFPH |
Sequence similarities
Belongs to the ligand-gated ion channel (TC 1.A.9) family. Acetylcholine receptor (TC 1.A.9.1) subfamily.
Keywords
- Domain
Family and domain databases
Sequence
- Sequence statusFragment
- Length559
- Mass (Da)62,443
- Last updated1998-06-01 v1
- Checksum6EB9B33F2778B3DE
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: R |