O43861 · ATP9B_HUMAN
- ProteinProbable phospholipid-transporting ATPase IIB
- GeneATP9B
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1147 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
Catalytic activity
Cofactor
Features
Showing features for active site, binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 468 | 4-aspartylphosphate intermediate | ||||
Sequence: D | ||||||
Binding site | 468 | ATP (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 468 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 469 | ATP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 470 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 470 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 591 | ATP (UniProtKB | ChEBI) | ||||
Sequence: E | ||||||
Binding site | 633 | ATP (UniProtKB | ChEBI) | ||||
Sequence: F | ||||||
Binding site | 638 | ATP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 657 | ATP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 686 | ATP (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 687 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 766 | ATP (UniProtKB | ChEBI) | ||||
Sequence: T | ||||||
Binding site | 767 | ATP (UniProtKB | ChEBI) | ||||
Sequence: G | ||||||
Binding site | 768 | ATP (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 848 | ATP (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 854 | ATP (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 874 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 877 | ATP (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 878 | ATP (UniProtKB | ChEBI) | ||||
Sequence: D | ||||||
Binding site | 878 | Mg2+ (UniProtKB | ChEBI) | ||||
Sequence: D |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endosome | |
Cellular Component | perinuclear region of cytoplasm | |
Cellular Component | plasma membrane | |
Cellular Component | trans-Golgi network | |
Molecular Function | ATP binding | |
Molecular Function | ATP hydrolysis activity | |
Molecular Function | ATPase-coupled intramembrane lipid transporter activity | |
Molecular Function | magnesium ion binding | |
Biological Process | endocytosis | |
Biological Process | phospholipid translocation | |
Biological Process | retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProbable phospholipid-transporting ATPase IIB
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO43861
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-146 | Cytoplasmic | ||||
Sequence: MADQIPLYPVRSAAAAAANRKRAAYYSAAGPRPGADRHSRYQLEDESAHLDEMPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCDGWKFLCTSCCGWLINICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFI | ||||||
Transmembrane | 147-168 | Helical | ||||
Sequence: PGVLYEQFKFFLNLYFLVISCS | ||||||
Topological domain | 169-173 | Extracellular | ||||
Sequence: QFVPA | ||||||
Transmembrane | 174-196 | Helical | ||||
Sequence: LKIGYLYTYWAPLGFVLAVTMTR | ||||||
Topological domain | 197-380 | Cytoplasmic | ||||
Sequence: EAIDEFRRFQRDKEVNSQLYSKLTVRGKVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLDGETDWKLKVAVSCTQQLPALGDLFSISAYVYAQKPQMDIHSFEGTFTREDSDPPIHESLSIENTLWASTIVASGTVIGVVIYTGKETRSVMNTSNPKNKVGLLDLELNRL | ||||||
Transmembrane | 381-401 | Helical | ||||
Sequence: TKALFLALVALSIVMVTLQGF | ||||||
Topological domain | 402-409 | Extracellular | ||||
Sequence: VGPWYRNL | ||||||
Transmembrane | 410-431 | Helical | ||||
Sequence: FRFLLLFSYIIPISLRVNLDMG | ||||||
Topological domain | 432-930 | Cytoplasmic | ||||
Sequence: KAVYGWMMMKDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMIFKRLHLGTVSYGADTMDEIQSHVRDSYSQMQSQAGGNNTGSTPLRKAQSSAPKVRKSVSSRIHEAVKAIVLCHNVTPVYESRAGVTEETEFAEADQDFSDENRTYQASSPDEVALVQWTESVGLTLVSRDLTSMQLKTPSGQVLSFCILQLFPFTSESKRMGVIVRDESTAEITFYMKGADVAMSPIVQYNDWLEEECGNMAREGLRTLVVAKKALTEEQYQDFESRYTQAKLSMHDRSLKVAAVVESLEREMELLCLTGVEDQLQADVRPTLEMLRNAGIKIWMLTGDKLETATCIAKSSHLVSRTQDIHIFRQVTSRGEAHLELNAFRRKHDCALVISGDSLEVCLKYYEHEFVELACQCPAVVCCRCSPTQKARIVTLLQQHTGRRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFRHIGRLLMVHGRNSYKRSAA | ||||||
Transmembrane | 931-951 | Helical | ||||
Sequence: LGQFVMHRGLIISTMQAVFSS | ||||||
Topological domain | 952-963 | Extracellular | ||||
Sequence: VFYFASVPLYQG | ||||||
Transmembrane | 964-982 | Helical | ||||
Sequence: FLMVGYATIYTMFPVFSLV | ||||||
Topological domain | 983-1012 | Cytoplasmic | ||||
Sequence: LDQDVKPEMAMLYPELYKDLTKGRSLSFKT | ||||||
Transmembrane | 1013-1031 | Helical | ||||
Sequence: FLIWVLISIYQGGILMYGA | ||||||
Topological domain | 1032-1038 | Extracellular | ||||
Sequence: LVLFESE | ||||||
Transmembrane | 1039-1061 | Helical | ||||
Sequence: FVHVVAISFTALILTELLMVALT | ||||||
Topological domain | 1062-1067 | Cytoplasmic | ||||
Sequence: VRTWHW | ||||||
Transmembrane | 1068-1088 | Helical | ||||
Sequence: LMVVAEFLSLGCYVSSLAFLN | ||||||
Topological domain | 1089-1105 | Extracellular | ||||
Sequence: EYFGIGRVSFGAFLDVA | ||||||
Transmembrane | 1106-1130 | Helical | ||||
Sequence: FITTVTFLWKVSAITVVSCLPLYVL | ||||||
Topological domain | 1131-1147 | Cytoplasmic | ||||
Sequence: KYLRRKLSPPSYCKLAS |
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_047557 | 39 | in dbSNP:rs4078115 | |||
Sequence: S → G | ||||||
Natural variant | VAR_061037 | 108 | in dbSNP:rs34938281 | |||
Sequence: R → Q | ||||||
Natural variant | VAR_047558 | 504 | in dbSNP:rs36034863 | |||
Sequence: D → N | ||||||
Natural variant | VAR_047559 | 732 | in dbSNP:rs585033 | |||
Sequence: M → L |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1,329 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000046377 | 1-1147 | UniProt | Probable phospholipid-transporting ATPase IIB | |||
Sequence: MADQIPLYPVRSAAAAAANRKRAAYYSAAGPRPGADRHSRYQLEDESAHLDEMPLMMSEEGFENEESDYHTLPRARIMQRKRGLEWFVCDGWKFLCTSCCGWLINICRRKKELKARTVWLGCPEKCEEKHPRNSIKNQKYNVFTFIPGVLYEQFKFFLNLYFLVISCSQFVPALKIGYLYTYWAPLGFVLAVTMTREAIDEFRRFQRDKEVNSQLYSKLTVRGKVQVKSSDIQVGDLIIVEKNQRIPSDMVFLRTSEKAGSCFIRTDQLDGETDWKLKVAVSCTQQLPALGDLFSISAYVYAQKPQMDIHSFEGTFTREDSDPPIHESLSIENTLWASTIVASGTVIGVVIYTGKETRSVMNTSNPKNKVGLLDLELNRLTKALFLALVALSIVMVTLQGFVGPWYRNLFRFLLLFSYIIPISLRVNLDMGKAVYGWMMMKDENIPGTVVRTSTIPEELGRLVYLLTDKTGTLTQNEMIFKRLHLGTVSYGADTMDEIQSHVRDSYSQMQSQAGGNNTGSTPLRKAQSSAPKVRKSVSSRIHEAVKAIVLCHNVTPVYESRAGVTEETEFAEADQDFSDENRTYQASSPDEVALVQWTESVGLTLVSRDLTSMQLKTPSGQVLSFCILQLFPFTSESKRMGVIVRDESTAEITFYMKGADVAMSPIVQYNDWLEEECGNMAREGLRTLVVAKKALTEEQYQDFESRYTQAKLSMHDRSLKVAAVVESLEREMELLCLTGVEDQLQADVRPTLEMLRNAGIKIWMLTGDKLETATCIAKSSHLVSRTQDIHIFRQVTSRGEAHLELNAFRRKHDCALVISGDSLEVCLKYYEHEFVELACQCPAVVCCRCSPTQKARIVTLLQQHTGRRTCAIGDGGNDVSMIQAADCGIGIEGKEGKQASLAADFSITQFRHIGRLLMVHGRNSYKRSAALGQFVMHRGLIISTMQAVFSSVFYFASVPLYQGFLMVGYATIYTMFPVFSLVLDQDVKPEMAMLYPELYKDLTKGRSLSFKTFLIWVLISIYQGGILMYGALVLFESEFVHVVAISFTALILTELLMVALTVRTWHWLMVVAEFLSLGCYVSSLAFLNEYFGIGRVSFGAFLDVAFITTVTFLWKVSAITVVSCLPLYVLKYLRRKLSPPSYCKLAS | |||||||
Modified residue (large scale data) | 521 | PRIDE | Phosphothreonine | ||||
Sequence: T |
Proteomic databases
PTM databases
Expression
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 503-535 | Disordered | ||||
Sequence: RDSYSQMQSQAGGNNTGSTPLRKAQSSAPKVRK |
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
O43861-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length1,147
- Mass (Da)129,304
- Last updated2008-11-25 v4
- Checksum1C3787BF07EFD637
O43861-2
- Name2
- Differences from canonical
- 1092-1102: Missing
Computationally mapped potential isoform sequences
There are 13 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
K7EII3 | K7EII3_HUMAN | ATP9B | 145 | ||
K7EJG1 | K7EJG1_HUMAN | ATP9B | 100 | ||
B4DJ94 | B4DJ94_HUMAN | ATP9B | 188 | ||
A0A0J9YYD2 | A0A0J9YYD2_HUMAN | ATP9B | 98 | ||
A0A0G2JNU9 | A0A0G2JNU9_HUMAN | ATP9B | 39 | ||
K7EJP9 | K7EJP9_HUMAN | ATP9B | 140 | ||
K7EJS3 | K7EJS3_HUMAN | ATP9B | 18 | ||
K7EL57 | K7EL57_HUMAN | ATP9B | 80 | ||
K7EQ39 | K7EQ39_HUMAN | ATP9B | 37 | ||
K7EPH4 | K7EPH4_HUMAN | ATP9B | 289 | ||
K7EQQ5 | K7EQQ5_HUMAN | ATP9B | 200 | ||
K7ES39 | K7ES39_HUMAN | ATP9B | 140 | ||
K7ERE0 | K7ERE0_HUMAN | ATP9B | 192 |
Features
Showing features for sequence conflict, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 886 | in Ref. 4; AAC05243 | ||||
Sequence: D → N | ||||||
Sequence conflict | 1006 | in Ref. 4; AAC05243 | ||||
Sequence: R → K | ||||||
Sequence conflict | 1020 | in Ref. 4; AAC05243 | ||||
Sequence: S → I | ||||||
Sequence conflict | 1036 | in Ref. 4; AAC05243 | ||||
Sequence: E → D | ||||||
Sequence conflict | 1073 | in Ref. 4; AAC05243 | ||||
Sequence: E → D | ||||||
Alternative sequence | VSP_035790 | 1092-1102 | in isoform 2 | |||
Sequence: Missing | ||||||
Sequence conflict | 1095 | in Ref. 4; AAC05243 | ||||
Sequence: R → K | ||||||
Sequence conflict | 1103 | in Ref. 4; AAC05243 | ||||
Sequence: D → N | ||||||
Sequence conflict | 1131 | in Ref. 4; AAC05243 | ||||
Sequence: K → N |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC023090 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC099689 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC104423 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC125437 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC125219 EMBL· GenBank· DDBJ | AAI25220.1 EMBL· GenBank· DDBJ | mRNA | ||
BC125220 EMBL· GenBank· DDBJ | AAI25221.1 EMBL· GenBank· DDBJ | mRNA | ||
AK097757 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
U78978 EMBL· GenBank· DDBJ | AAC05243.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ006268 EMBL· GenBank· DDBJ | CAA06934.1 EMBL· GenBank· DDBJ | mRNA |