O43557 · TNF14_HUMAN
- ProteinTumor necrosis factor ligand superfamily member 14
- GeneTNFSF14
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids240 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Acts as a ligand for TNFRSF14/HVEM (PubMed:10754304, PubMed:9462508).
Upon binding to TNFRSF14/HVEM, delivers costimulatory signals to T cells, leading to T cell proliferation and IFNG production (PubMed:10754304).
Upon binding to TNFRSF14/HVEM, delivers costimulatory signals to T cells, leading to T cell proliferation and IFNG production (PubMed:10754304).
Features
Showing features for site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Site | 82-83 | Cleavage | ||||
Sequence: QL |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | extracellular space | |
Cellular Component | plasma membrane | |
Molecular Function | cysteine-type endopeptidase inhibitor activity involved in apoptotic process | |
Molecular Function | cytokine activity | |
Molecular Function | identical protein binding | |
Molecular Function | signaling receptor binding | |
Molecular Function | tumor necrosis factor receptor binding | |
Biological Process | apoptotic process | |
Biological Process | cellular response to mechanical stimulus | |
Biological Process | immune response | |
Biological Process | positive regulation of myoblast differentiation | |
Biological Process | positive regulation of myoblast fusion | |
Biological Process | positive regulation of non-canonical NF-kappaB signal transduction | |
Biological Process | positive regulation of T cell chemotaxis | |
Biological Process | signal transduction | |
Biological Process | T cell activation | |
Biological Process | T cell chemotaxis | |
Biological Process | T cell costimulation | |
Biological Process | T cell homeostasis | |
Biological Process | T cell proliferation |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTumor necrosis factor ligand superfamily member 14
- Alternative names
- Cleaved into 2 chains
- CD Antigen Name
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO43557
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Tumor necrosis factor ligand superfamily member 14, membrane form
Cell membrane ; Single-pass type II membrane protein
Tumor necrosis factor ligand superfamily member 14, soluble form
Isoform 2
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-37 | Cytoplasmic | ||||
Sequence: MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVAR | ||||||
Transmembrane | 38-58 | Helical; Signal-anchor for type II membrane protein | ||||
Sequence: VGLGLLLLLMGAGLAVQGWFL | ||||||
Topological domain | 59-240 | Extracellular | ||||
Sequence: LQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV |
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_027677 | 32 | in dbSNP:rs2291667 | |||
Sequence: S → L | ||||||
Natural variant | VAR_027678 | 120 | in dbSNP:rs17851606 | |||
Sequence: L → V | ||||||
Natural variant | VAR_027679 | 214 | in dbSNP:rs344560 | |||
Sequence: K → E |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 274 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Chemistry
Genetic variation databases
PTM/Processing
Features
Showing features for chain, glycosylation, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000034532 | 1-240 | Tumor necrosis factor ligand superfamily member 14, membrane form | |||
Sequence: MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV | ||||||
Chain | PRO_0000034533 | ?83-240 | Tumor necrosis factor ligand superfamily member 14, soluble form | |||
Sequence: LIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV | ||||||
Glycosylation | 102 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 154↔187 | |||||
Sequence: CPLGLASTITHGLYKRTPRYPEELELLVSQQSPC |
Post-translational modification
N-glycosylated.
The soluble form of isoform 1 derives from the membrane form by proteolytic processing.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Predominantly expressed in the spleen but also found in the brain. Weakly expressed in peripheral lymphoid tissues and in heart, placenta, liver, lung, appendix, and kidney, and no expression seen in fetal tissues, endocrine glands, or nonhematopoietic tumor lines.
Induction
Up-regulated after T-cell activation.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Homotrimer. Interacts with TNFRSF14.
Binary interactions
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 94-240 | THD | ||||
Sequence: PAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV |
Sequence similarities
Belongs to the tumor necrosis factor family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
O43557-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length240
- Mass (Da)26,350
- Last updated2010-11-30 v2
- Checksum49D0B1870F390B39
O43557-2
- Name2
- SynonymsLIGHT delta-TM
- Differences from canonical
- 38-73: Missing
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_006452 | 38-73 | in isoform 2 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF036581 EMBL· GenBank· DDBJ | AAC39563.1 EMBL· GenBank· DDBJ | mRNA | ||
AF064090 EMBL· GenBank· DDBJ | AAC25169.1 EMBL· GenBank· DDBJ | mRNA | ||
AY028261 EMBL· GenBank· DDBJ | AAK26160.1 EMBL· GenBank· DDBJ | mRNA | ||
AY358812 EMBL· GenBank· DDBJ | AAQ89171.1 EMBL· GenBank· DDBJ | mRNA | ||
AK292037 EMBL· GenBank· DDBJ | BAF84726.1 EMBL· GenBank· DDBJ | mRNA | ||
CR541854 EMBL· GenBank· DDBJ | CAG46652.1 EMBL· GenBank· DDBJ | mRNA | ||
CR541871 EMBL· GenBank· DDBJ | CAG46669.1 EMBL· GenBank· DDBJ | mRNA | ||
AC008760 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471139 EMBL· GenBank· DDBJ | EAW69072.1 EMBL· GenBank· DDBJ | Genomic DNA |