O43491 · E41L2_HUMAN
- ProteinBand 4.1-like protein 2
- GeneEPB41L2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1005 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Required for dynein-dynactin complex and NUMA1 recruitment at the mitotic cell cortex during anaphase (PubMed:23870127).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cell cortex | |
Cellular Component | cell junction | |
Cellular Component | cytoskeleton | |
Cellular Component | cytosol | |
Cellular Component | extracellular exosome | |
Cellular Component | focal adhesion | |
Cellular Component | nucleoplasm | |
Cellular Component | plasma membrane | |
Cellular Component | spectrin | |
Molecular Function | actin binding | |
Molecular Function | PH domain binding | |
Molecular Function | spectrin binding | |
Molecular Function | structural molecule activity | |
Biological Process | actomyosin structure organization | |
Biological Process | cell division | |
Biological Process | cortical actin cytoskeleton organization | |
Biological Process | positive regulation of protein localization to cell cortex |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameBand 4.1-like protein 2
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO43491
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_020145 | 17 | in dbSNP:rs2297852 | |||
Sequence: Q → H |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 1,241 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for initiator methionine, modified residue, modified residue (large scale data), chain, cross-link.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Initiator methionine | 1 | UniProt | Removed | ||||
Sequence: M | |||||||
Modified residue | 2 | UniProt | N-acetylthreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 2 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Chain | PRO_0000219397 | 2-1005 | UniProt | Band 4.1-like protein 2 | |||
Sequence: TTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPPWLKKQKSYTLVVAKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKETQEDKLEGGAAKRETKEVQTNELKAEKASQKVTKKTKTVQCKVTLLDGTEYSCDLEKHAKGQVLFDKVCEHLNLLEKDYFGLLFQESPEQKNWLDPAKEIKRQLRNLPWLFTFNVKFYPPDPSQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDPEEHGSIDLSEFQFAPTQTKELEEKVAELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCVEHHTFYRLVSPEQPPKAKFLTLGSKFRYSGRTQAQTRQASTLIDRPAPHFERTSSKRVSRSLDGAPIGVMDQSLMKDFPGAAGEISAYGPGLVSIAVVQDGDGRREVRSPTKAPHLQLIEGKKNSLRVEGDNIYVRHSNLMLEELDKAQEDILKHQASISELKRNFMESTPEPRPNEWEKRRITPLSLQTQGSSHETLNIVEEKKRAEVGKDERVITEEMNGKEISPGSGPGEIRKVEPVTQKDSTSLSSESSSSSSESEEEDVGEYRPHHRVTEGTIREEQEYEEEVEEEPRPAAKVVEREEAVPEASPVTQAGASVITVETVIQENVGAQKIPGEKSVHEGALKQDMGEEAEEEPQKVNGEVSHVDIDVLPQIICCSEPPVVKTEMVTISDASQRTEISTKEVPIVQTETKTITYESPQIDGGAGGDSGTLLTAQTITSESVSTTTTTHITKTVKGGISETRIEKRIVITGDGDIDHDQALAQAIREAREQHPDMSVTRVVVHKETELAEEGED | |||||||
Modified residue | 7 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 7 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 9 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 15 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 16 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 38 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 39 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 39 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 47 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 55 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 57 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 58 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 58 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 87 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 87 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 88 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue | 89 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 89 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Cross-link | 140 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 144 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 170 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 170 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 194 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 208 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 386 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 386 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 402 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 402 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 499 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 499 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 518 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 548 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 550 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 550 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 562 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 562 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 575 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 577 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue | 598 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 598 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 600 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 614 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 614 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 623 | UniProt | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 623 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue | 627 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 627 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 647 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 647 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 649 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 658 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 659 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 673 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 679 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 682 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 683 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 686 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 715 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 715 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 718 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 718 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 748 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 763 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 763 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 773 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 798 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 801 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 828 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 828 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 881 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 884 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 906 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 908 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 950 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 987 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Widely expressed.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with FCGR1A (PubMed:18023480).
Interacts with TRPC4 (PubMed:16254212).
Interacts (via CTD domain) with FKBP2 (By similarity).
Interacts with NUMA1; this interaction is negatively regulated by CDK1 during metaphase and promotes anaphase-specific localization of NUMA1 in symmetrically dividing cells (PubMed:23870127).
Interacts with TRPC4 (PubMed:16254212).
Interacts (via CTD domain) with FKBP2 (By similarity).
Interacts with NUMA1; this interaction is negatively regulated by CDK1 during metaphase and promotes anaphase-specific localization of NUMA1 in symmetrically dividing cells (PubMed:23870127).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O43491 | FCGR1A P12314 | 3 | EBI-1052044, EBI-2869867 | |
BINARY | O43491 | SFN P31947 | 3 | EBI-1052044, EBI-476295 | |
BINARY | O43491 | YWHAE P62258 | 3 | EBI-1052044, EBI-356498 | |
BINARY | O43491 | YWHAG P61981 | 8 | EBI-1052044, EBI-359832 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-16 | Polar residues | ||||
Sequence: MTTEVGSVSEVKKDSS | ||||||
Region | 1-80 | Disordered | ||||
Sequence: MTTEVGSVSEVKKDSSQLGTDATKEKPKEVAENQQNQSSDPEEEKGSQPPPAAESQSSLRRQKREKETSESRGISRFIPP | ||||||
Compositional bias | 17-31 | Basic and acidic residues | ||||
Sequence: QLGTDATKEKPKEVA | ||||||
Compositional bias | 32-57 | Polar residues | ||||
Sequence: ENQQNQSSDPEEEKGSQPPPAAESQS | ||||||
Compositional bias | 58-72 | Basic and acidic residues | ||||
Sequence: SLRRQKREKETSESR | ||||||
Region | 93-196 | Disordered | ||||
Sequence: AKDGGDKKEPTQAVVEEQVLDKEEPLPEEQRQAKGDAEEMAQKKQEIKVEVKEEKPSVSKEEKPSVSKVEMQPTELVSKEREEKVKETQEDKLEGGAAKRETKE | ||||||
Domain | 218-499 | FERM | ||||
Sequence: VQCKVTLLDGTEYSCDLEKHAKGQVLFDKVCEHLNLLEKDYFGLLFQESPEQKNWLDPAKEIKRQLRNLPWLFTFNVKFYPPDPSQLTEDITRYFLCLQLRQDIASGRLPCSFVTHALLGSYTLQAELGDYDPEEHGSIDLSEFQFAPTQTKELEEKVAELHKTHRGLSPAQADSQFLENAKRLSMYGVDLHHAKDSEGVDIKLGVCANGLLIYKDRLRINRFAWPKILKISYKRSNFYIKVRPAELEQFESTIGFKLPNHRAAKRLWKVCVEHHTFYRLVS | ||||||
Region | 502-610 | Hydrophilic | ||||
Sequence: QPPKAKFLTLGSKFRYSGRTQAQTRQASTLIDRPAPHFERTSSKRVSRSLDGAPIGVMDQSLMKDFPGAAGEISAYGPGLVSIAVVQDGDGRREVRSPTKAPHLQLIEG | ||||||
Region | 611-676 | Spectrin--actin-binding | ||||
Sequence: KKNSLRVEGDNIYVRHSNLMLEELDKAQEDILKHQASISELKRNFMESTPEPRPNEWEKRRITPLS | ||||||
Region | 652-800 | Disordered | ||||
Sequence: KRNFMESTPEPRPNEWEKRRITPLSLQTQGSSHETLNIVEEKKRAEVGKDERVITEEMNGKEISPGSGPGEIRKVEPVTQKDSTSLSSESSSSSSESEEEDVGEYRPHHRVTEGTIREEQEYEEEVEEEPRPAAKVVEREEAVPEASPV | ||||||
Compositional bias | 656-670 | Basic and acidic residues | ||||
Sequence: MESTPEPRPNEWEKR | ||||||
Compositional bias | 672-686 | Polar residues | ||||
Sequence: ITPLSLQTQGSSHET | ||||||
Compositional bias | 687-709 | Basic and acidic residues | ||||
Sequence: LNIVEEKKRAEVGKDERVITEEM | ||||||
Compositional bias | 730-744 | Polar residues | ||||
Sequence: TQKDSTSLSSESSSS | ||||||
Compositional bias | 750-768 | Basic and acidic residues | ||||
Sequence: EEDVGEYRPHHRVTEGTIR | ||||||
Compositional bias | 779-793 | Basic and acidic residues | ||||
Sequence: EEPRPAAKVVEREEA | ||||||
Region | 855-1005 | C-terminal (CTD) | ||||
Sequence: HVDIDVLPQIICCSEPPVVKTEMVTISDASQRTEISTKEVPIVQTETKTITYESPQIDGGAGGDSGTLLTAQTITSESVSTTTTTHITKTVKGGISETRIEKRIVITGDGDIDHDQALAQAIREAREQHPDMSVTRVVVHKETELAEEGED |
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 4 isoforms produced by Alternative splicing.
O43491-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length1,005
- Mass (Da)112,588
- Last updated1998-06-01 v1
- ChecksumE86CB17488F6045F
O43491-2
- Name2
- Differences from canonical
- 612-943: Missing
O43491-3
- Name3
- Differences from canonical
- 612-869: Missing
O43491-4
- Name4
Computationally mapped potential isoform sequences
There are 17 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A2R8Y5B3 | A0A2R8Y5B3_HUMAN | EPB41L2 | 824 | ||
H0Y5B0 | H0Y5B0_HUMAN | EPB41L2 | 380 | ||
Q6R5J7 | Q6R5J7_HUMAN | EPB41L2 | 383 | ||
Q6ZSX4 | Q6ZSX4_HUMAN | EPB41L2 | 201 | ||
E9PRG1 | E9PRG1_HUMAN | EPB41L2 | 153 | ||
E9PPC9 | E9PPC9_HUMAN | EPB41L2 | 126 | ||
E9PQN0 | E9PQN0_HUMAN | EPB41L2 | 127 | ||
E9PQD2 | E9PQD2_HUMAN | EPB41L2 | 179 | ||
E9PMG5 | E9PMG5_HUMAN | EPB41L2 | 224 | ||
E9PMV8 | E9PMV8_HUMAN | EPB41L2 | 268 | ||
E9PN54 | E9PN54_HUMAN | EPB41L2 | 240 | ||
E9PJP4 | E9PJP4_HUMAN | EPB41L2 | 118 | ||
E9PK52 | E9PK52_HUMAN | EPB41L2 | 811 | ||
E9PHY5 | E9PHY5_HUMAN | EPB41L2 | 935 | ||
E9PIG0 | E9PIG0_HUMAN | EPB41L2 | 162 | ||
E9PII3 | E9PII3_HUMAN | EPB41L2 | 706 | ||
A0A994J5B1 | A0A994J5B1_HUMAN | EPB41L2 | 1057 |
Features
Showing features for compositional bias, alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-16 | Polar residues | ||||
Sequence: MTTEVGSVSEVKKDSS | ||||||
Compositional bias | 17-31 | Basic and acidic residues | ||||
Sequence: QLGTDATKEKPKEVA | ||||||
Compositional bias | 32-57 | Polar residues | ||||
Sequence: ENQQNQSSDPEEEKGSQPPPAAESQS | ||||||
Compositional bias | 58-72 | Basic and acidic residues | ||||
Sequence: SLRRQKREKETSESR | ||||||
Alternative sequence | VSP_047181 | 612-681 | in isoform 4 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_045090 | 612-869 | in isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_042910 | 612-943 | in isoform 2 | |||
Sequence: Missing | ||||||
Compositional bias | 656-670 | Basic and acidic residues | ||||
Sequence: MESTPEPRPNEWEKR | ||||||
Compositional bias | 672-686 | Polar residues | ||||
Sequence: ITPLSLQTQGSSHET | ||||||
Compositional bias | 687-709 | Basic and acidic residues | ||||
Sequence: LNIVEEKKRAEVGKDERVITEEM | ||||||
Compositional bias | 730-744 | Polar residues | ||||
Sequence: TQKDSTSLSSESSSS | ||||||
Compositional bias | 750-768 | Basic and acidic residues | ||||
Sequence: EEDVGEYRPHHRVTEGTIR | ||||||
Compositional bias | 779-793 | Basic and acidic residues | ||||
Sequence: EEPRPAAKVVEREEA | ||||||
Alternative sequence | VSP_047182 | 787-869 | in isoform 4 | |||
Sequence: Missing |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF027299 EMBL· GenBank· DDBJ | AAC16923.1 EMBL· GenBank· DDBJ | mRNA | ||
AY047584 EMBL· GenBank· DDBJ | AAK95850.1 EMBL· GenBank· DDBJ | mRNA | ||
AK295124 EMBL· GenBank· DDBJ | BAG58150.1 EMBL· GenBank· DDBJ | mRNA | ||
CR749262 EMBL· GenBank· DDBJ | CAH18118.1 EMBL· GenBank· DDBJ | mRNA | ||
AL109938 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL357496 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL355360 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL358943 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL590014 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471051 EMBL· GenBank· DDBJ | EAW48062.1 EMBL· GenBank· DDBJ | Genomic DNA |