O43390 · HNRPR_HUMAN
- ProteinHeterogeneous nuclear ribonucleoprotein R
- GeneHNRNPR
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids633 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | catalytic step 2 spliceosome | |
Cellular Component | endoplasmic reticulum | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | ribonucleoprotein complex | |
Cellular Component | spliceosomal complex | |
Molecular Function | mRNA binding | |
Molecular Function | RNA binding | |
Biological Process | mRNA processing | |
Biological Process | mRNA splicing, via spliceosome |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameHeterogeneous nuclear ribonucleoprotein R
- Short nameshnRNP R
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO43390
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Keywords
- Cellular component
Disease & Variants
Involvement in disease
Neurodevelopmental disorder with dysmorphic facies and skeletal and brain abnormalities (NEDDFSB)
- Note
- DescriptionAn autosomal dominant disorder characterized by global developmental delay with impaired intellectual development and poor or absent speech, corpus callosum structural defects and cerebellar hypoplasia on brain imaging, poor overall growth, facial dysmorphism, and skeletal defects. Variable additional findings include hypotonia, seizures, and ocular defects.
- See alsoMIM:620073
Natural variants in NEDDFSB
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_087802 | 552-633 | missing | in NEDDFSB | |
VAR_087803 | 585 | R>H | in NEDDFSB |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_087802 | 552-633 | in NEDDFSB | |||
Sequence: Missing | ||||||
Natural variant | VAR_087803 | 585 | in NEDDFSB | |||
Sequence: R → H |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 893 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain, cross-link, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Initiator methionine | 1 | UniProt | Removed | ||||
Sequence: M | |||||||
Modified residue | 2 | UniProt | N-acetylalanine | ||||
Sequence: A | |||||||
Chain | PRO_0000081870 | 2-633 | UniProt | Heterogeneous nuclear ribonucleoprotein R | |||
Sequence: ANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQTGLVAYVDLDERAIDALREFNEEGALSVLQQFKESDLSHVQNKSAFLCGVMKTYRQREKQGSKVQESTKGPDEAKIKALLERTGYTLDVTTGQRKYGGPPPDSVYSGVQPGIGTEVFVGKIPRDLYEDELVPLFEKAGPIWDLRLMMDPLSGQNRGYAFITFCGKEAAQEAVKLCDSYEIRPGKHLGVCISVANNRLFVGSIPKNKTKENILEEFSKVTEGLVDVILYHQPDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVVTVEWADPVEEPDPEVMAKVKVLFVRNLATTVTEEILEKSFSEFGKLERVKKLKDYAFVHFEDRGAAVKAMDEMNGKEIEGEEIEIVLAKPPDKKRKERQAARQASRSTAYEDYYYHPPPRMPPPIRGRGRGGGRGGYGYPPDYYGYEDYYDDYYGYDYHDYRGGYEDPYYGYDDGYAVRGRGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGPPRGSRGGRGGPAQQQRGRGSRGSRGNRGGNVGGKRKADGYNQPDSKRRQTNNQQNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK | |||||||
Cross-link | 13 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 22 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 23 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 32 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 57 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 78 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 171 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 228 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 252 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 351 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Cross-link | 359 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 366 | UniProt | N6-acetyllysine | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 426 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 431 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 434 | PRIDE | Phosphotyrosine | ||||
Sequence: Y | |||||||
Modified residue (large scale data) | 435 | PRIDE | Phosphotyrosine | ||||
Sequence: Y |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O43390 | KHDRBS2 Q5VWX1 | 3 | EBI-713419, EBI-742808 | |
BINARY | O43390 | NCK1 P16333 | 2 | EBI-713419, EBI-389883 | |
BINARY | O43390 | PRMT1 Q99873 | 5 | EBI-713419, EBI-78738 | |
BINARY | O43390-2 | PCDHB14 Q9Y5E9 | 3 | EBI-12236340, EBI-10329013 | |
BINARY | O43390-2 | RASD1 Q9Y272 | 3 | EBI-12236340, EBI-740818 | |
BINARY | O43390-2 | TARDBP Q13148 | 3 | EBI-12236340, EBI-372899 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain, motif, repeat, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-24 | Disordered | ||||
Sequence: MANQVNGNAVQLKEEEEPMDTSSV | ||||||
Domain | 165-244 | RRM 1 | ||||
Sequence: TEVFVGKIPRDLYEDELVPLFEKAGPIWDLRLMMDPLSGQNRGYAFITFCGKEAAQEAVKLCDSYEIRPGKHLGVCISVA | ||||||
Domain | 246-328 | RRM 2 | ||||
Sequence: NRLFVGSIPKNKTKENILEEFSKVTEGLVDVILYHQPDDKKKNRGFCFLEYEDHKSAAQARRRLMSGKVKVWGNVVTVEWADP | ||||||
Domain | 341-411 | RRM 3 | ||||
Sequence: KVLFVRNLATTVTEEILEKSFSEFGKLERVKKLKDYAFVHFEDRGAAVKAMDEMNGKEIEGEEIEIVLAKP | ||||||
Motif | 412-418 | Nuclear localization signal | ||||
Sequence: PDKKRKE | ||||||
Region | 412-456 | Disordered | ||||
Sequence: PDKKRKERQAARQASRSTAYEDYYYHPPPRMPPPIRGRGRGGGRG | ||||||
Region | 447-567 | RNA-binding RGG-box | ||||
Sequence: RGRGRGGGRGGYGYPPDYYGYEDYYDDYYGYDYHDYRGGYEDPYYGYDDGYAVRGRGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGPPRGSRGGRGGPAQQQRGRGSRGSRGNRGG | ||||||
Repeat | 462-471 | 1; approximate | ||||
Sequence: PDYYGYEDYY | ||||||
Region | 462-497 | 3 X 11 AA approximate repeats of D-D-Y-Y-G-Y-D-Y-H-D-Y | ||||
Sequence: PDYYGYEDYYDDYYGYDYHDYRGGYEDPYYGYDDGY | ||||||
Repeat | 472-482 | 2 | ||||
Sequence: DDYYGYDYHDY | ||||||
Repeat | 488-497 | 3; approximate | ||||
Sequence: DPYYGYDDGY | ||||||
Region | 501-633 | Disordered | ||||
Sequence: GRGGGRGGRGAPPPPRGRGAPPPRGRAGYSQRGAPLGPPRGSRGGRGGPAQQQRGRGSRGSRGNRGGNVGGKRKADGYNQPDSKRRQTNNQQNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK | ||||||
Compositional bias | 582-633 | Polar residues | ||||
Sequence: DSKRRQTNNQQNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 4 isoforms produced by Alternative splicing.
O43390-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length633
- Mass (Da)70,943
- Last updated1998-06-01 v1
- Checksum088341F6465ED46F
O43390-2
- Name2
- Differences from canonical
- 269-269: V → VTGL
O43390-3
- Name3
- SynonymshnRNP-R2
- NoteExpression is low and neural-specific.
- Differences from canonical
- 129-166: Missing
O43390-4
- Name4
Computationally mapped potential isoform sequences
There are 6 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A6Q8PH31 | A0A6Q8PH31_HUMAN | HNRNPR | 279 | ||
A0A6Q8PH35 | A0A6Q8PH35_HUMAN | HNRNPR | 481 | ||
A0A6Q8PEX7 | A0A6Q8PEX7_HUMAN | HNRNPR | 532 | ||
A0A6Q8PHG0 | A0A6Q8PHG0_HUMAN | HNRNPR | 574 | ||
A0A286YEZ8 | A0A286YEZ8_HUMAN | HNRNPR | 141 | ||
B4DT28 | B4DT28_HUMAN | HNRNPR | 494 |
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_054703 | 1-101 | in isoform 4 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_047647 | 129-166 | in isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_038360 | 269 | in isoform 2 and isoform 4 | |||
Sequence: V → VTGL | ||||||
Compositional bias | 582-633 | Polar residues | ||||
Sequence: DSKRRQTNNQQNWGSQPIAQQPLQQGGDYSGNYGYNNDNQEFYQDTYGQQWK |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF000364 EMBL· GenBank· DDBJ | AAC39540.1 EMBL· GenBank· DDBJ | mRNA | ||
DQ351905 EMBL· GenBank· DDBJ | ABC73063.1 EMBL· GenBank· DDBJ | mRNA | ||
AL109936 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC001449 EMBL· GenBank· DDBJ | AAH01449.1 EMBL· GenBank· DDBJ | mRNA |