O43307 · ARHG9_HUMAN
- ProteinRho guanine nucleotide exchange factor 9
- GeneARHGEF9
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids516 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Acts as a guanine nucleotide exchange factor (GEF) for CDC42. Promotes formation of GPHN clusters (By similarity).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | GABA-ergic synapse | |
Cellular Component | postsynaptic density | |
Cellular Component | postsynaptic specialization | |
Molecular Function | guanyl-nucleotide exchange factor activity | |
Biological Process | regulation of postsynaptic specialization assembly | |
Biological Process | regulation of small GTPase mediated signal transduction |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRho guanine nucleotide exchange factor 9
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO43307
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Involvement in disease
Developmental and epileptic encephalopathy 8 (DEE8)
- Note
- DescriptionA disorder characterized by hyperekplexia and early infantile epileptic encephalopathy. Neurologic features include exaggerated startle response, seizures, impaired psychomotor development, and intellectual disability. Seizures can be provoked by tactile stimulation or extreme emotion.
- See alsoMIM:300607
Natural variants in DEE8
Variant ID | Position(s) | Change | Description | |
---|---|---|---|---|
VAR_028752 | 55 | G>A | in DEE8; affects dendritic gephrin clustering and trafficking of GABA-A receptors to synapses; dbSNP:rs121918361 | |
VAR_072742 | 290 | R>H | in DEE8 |
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_028752 | 55 | in DEE8; affects dendritic gephrin clustering and trafficking of GABA-A receptors to synapses; dbSNP:rs121918361 | |||
Sequence: G → A | ||||||
Natural variant | VAR_072742 | 290 | in DEE8 | |||
Sequence: R → H | ||||||
Natural variant | VAR_069370 | 401 | found in a patient with moderate intellectual disability, speech delay and sleep disturbances; likely pathogenic | |||
Sequence: E → K |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 374 variants from UniProt as well as other sources including ClinVar and dbSNP.
Keywords
- Disease
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000253895 | 1-516 | Rho guanine nucleotide exchange factor 9 | |||
Sequence: MTLLITGDSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVRLWVNQEDEVEEGPSDVQNGHLDPNSDCLCLGRPLQNRDQMRANVINEIMSTERHYIKHLKDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINERKRRLENIDKIAQWQASVLDWEGEDILDRSSELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDILYYKGRIDMDKYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEIHLFFAKKLEEKIRWLRAFREERKMVQEDEKIGFEISENQKRQAAMTVRKVPKQKGVNSARSVPPSYPPPQDPLNHGQYLVPDGIAQSQVFEFTEPKRSQSPFWQNFSRLTPFKK | ||||||
Modified residue | 502 | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Detected in brain. Detected at low levels in heart.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with GPHN.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O43307 | FAM90A1 Q86YD7 | 3 | EBI-3447299, EBI-6658203 | |
BINARY | O43307 | FANCL Q9NW38 | 3 | EBI-3447299, EBI-2339898 | |
BINARY | O43307 | KAT5 Q92993 | 3 | EBI-3447299, EBI-399080 | |
BINARY | O43307 | LMO3 Q8TAP4-4 | 3 | EBI-3447299, EBI-11742507 | |
BINARY | O43307 | SETDB1 Q15047-2 | 3 | EBI-3447299, EBI-9090795 | |
BINARY | O43307 | TBC1D22B Q9NU19 | 3 | EBI-3447299, EBI-8787464 | |
BINARY | O43307 | TSGA10IP Q3SY00 | 3 | EBI-3447299, EBI-10241197 | |
BINARY | O43307 | VEZF1 Q14119 | 3 | EBI-3447299, EBI-11980193 | |
BINARY | O43307 | YWHAG P61981 | 3 | EBI-3447299, EBI-359832 | |
BINARY | O43307 | ZNF410 Q86VK4-3 | 3 | EBI-3447299, EBI-11741890 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 8-67 | SH3 | ||||
Sequence: DSIVSAEAVWDHVTMANRELAFKAGDVIKVLDASNKDWWWGQIDDEEGWFPASFVRLWVN | ||||||
Region | 100-110 | Interaction with GPHN | ||||
Sequence: RDQMRANVINE | ||||||
Domain | 103-287 | DH | ||||
Sequence: MRANVINEIMSTERHYIKHLKDICEGYLKQCRKRRDMFSDEQLKVIFGNIEDIYRFQMGFVRDLEKQYNNDDPHLSEIGPCFLEHQDGFWIYSEYCNNHLDACMELSKLMKDSRYQHFFEACRLLQQMIDIAIDGFLLTPVQKICKYPLQLAELLKYTAQDHSDYRYVAAALAVMRNVTQQINER | ||||||
Domain | 318-425 | PH | ||||
Sequence: ELIYTGEMAWIYQPYGRNQQRVFFLFDHQMVLCKKDLIRRDILYYKGRIDMDKYEVVDIEDGRDDDFNVSMKNAFKLHNKETEEIHLFFAKKLEEKIRWLRAFREERK | ||||||
Region | 453-480 | Disordered | ||||
Sequence: PKQKGVNSARSVPPSYPPPQDPLNHGQY |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 3 isoforms produced by Alternative splicing.
O43307-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsCB3(SH3+)
- Length516
- Mass (Da)60,982
- Last updated2006-10-17 v3
- ChecksumAAEE17366B46B707
O43307-2
- Name2
- SynonymsCB3(SH3-)
O43307-3
- Name3
- Differences from canonical
- 1-102: Missing
Computationally mapped potential isoform sequences
There are 22 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A096LNQ4 | A0A096LNQ4_HUMAN | ARHGEF9 | 108 | ||
A0A096LNK4 | A0A096LNK4_HUMAN | ARHGEF9 | 110 | ||
A0A096LNK7 | A0A096LNK7_HUMAN | ARHGEF9 | 91 | ||
A0A096LPE7 | A0A096LPE7_HUMAN | ARHGEF9 | 134 | ||
A0A096LP05 | A0A096LP05_HUMAN | ARHGEF9 | 115 | ||
A0A096LPI8 | A0A096LPI8_HUMAN | ARHGEF9 | 136 | ||
A0A1B0GVC4 | A0A1B0GVC4_HUMAN | ARHGEF9 | 454 | ||
A0A1B0GV82 | A0A1B0GV82_HUMAN | ARHGEF9 | 455 | ||
A0A1B0GV84 | A0A1B0GV84_HUMAN | ARHGEF9 | 506 | ||
A0A1B0GU85 | A0A1B0GU85_HUMAN | ARHGEF9 | 35 | ||
A0A1B0GTF0 | A0A1B0GTF0_HUMAN | ARHGEF9 | 263 | ||
A0A1B0GWI5 | A0A1B0GWI5_HUMAN | ARHGEF9 | 529 | ||
A0A1B0GVV2 | A0A1B0GVV2_HUMAN | ARHGEF9 | 458 | ||
A0A1B0GVX8 | A0A1B0GVX8_HUMAN | ARHGEF9 | 64 | ||
A0A1W2PQW9 | A0A1W2PQW9_HUMAN | ARHGEF9 | 56 | ||
A0A5F9ZI31 | A0A5F9ZI31_HUMAN | ARHGEF9 | 451 | ||
A0A5F9ZGZ3 | A0A5F9ZGZ3_HUMAN | ARHGEF9 | 489 | ||
A0A5F9ZHY9 | A0A5F9ZHY9_HUMAN | ARHGEF9 | 523 | ||
A0A0A6YYB3 | A0A0A6YYB3_HUMAN | ARHGEF9 | 483 | ||
A0A0A6YYF8 | A0A0A6YYF8_HUMAN | ARHGEF9 | 564 | ||
B1AMR3 | B1AMR3_HUMAN | ARHGEF9 | 495 | ||
B1AMR4 | B1AMR4_HUMAN | ARHGEF9 | 487 |
Sequence caution
Features
Showing features for alternative sequence, sequence conflict.
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB007884 EMBL· GenBank· DDBJ | BAA24854.2 EMBL· GenBank· DDBJ | mRNA | Different initiation | |
AK289993 EMBL· GenBank· DDBJ | BAF82682.1 EMBL· GenBank· DDBJ | mRNA | ||
AK295033 EMBL· GenBank· DDBJ | BAG58088.1 EMBL· GenBank· DDBJ | mRNA | ||
AL451106 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL391277 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AL355142 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
BC056892 EMBL· GenBank· DDBJ | - | mRNA | No translation available. | |
BC117406 EMBL· GenBank· DDBJ | AAI17407.1 EMBL· GenBank· DDBJ | mRNA |