O36005 · PHEA_GRIMO
- ProteinR-phycoerythrin alpha chain
- GenecpeA
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids164 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Light-harvesting photosynthetic tetrapyrrole chromophore-protein from the phycobiliprotein complex.
Miscellaneous
The light-harvesting antenna system in red algae and cyanobacteria is formed of phycobilisomes. These are composed of the phycobiliproteins phycoerythrin (CPE), phycocyanin (CPC) and allophycocyanin (APC). Cyanobacteria also contain phycoerythrocyanin (PCC). The phycobiliproteins all share the same subunit composition and organization with variations in the covalently bound open-chain tetrapyrrole chromophores. The phycobiliprotein complexes are arranged sequentially in antenna complexes linked by linker proteins with CPE at the periphery, CPC in the middle and APC at the core feeding to the photosynthetic reaction center.
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 47 | (2R,3E)-phycoerythrobilin 2 (UniProtKB | ChEBI) | ||||
Sequence: N | ||||||
Binding site | 81 | (2R,3E)-phycoerythrobilin 1 (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 82 | (2R,3E)-phycoerythrobilin 1 (UniProtKB | ChEBI); covalent | ||||
Sequence: C | ||||||
Binding site | 84 | (2R,3E)-phycoerythrobilin 1 (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 88 | (2R,3E)-phycoerythrobilin 1 (UniProtKB | ChEBI) | ||||
Sequence: H | ||||||
Binding site | 137 | (2R,3E)-phycoerythrobilin 2 (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 139 | (2R,3E)-phycoerythrobilin 2 (UniProtKB | ChEBI); covalent | ||||
Sequence: C | ||||||
Binding site | 142 | (2R,3E)-phycoerythrobilin 2 (UniProtKB | ChEBI) | ||||
Sequence: R |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | phycobilisome | |
Biological Process | photosynthesis |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameR-phycoerythrin alpha chain
Gene names
Encoded on
- Chloroplast
Organism names
- Organism
- Taxonomic lineageEukaryota > Rhodophyta > Florideophyceae > Rhodymeniophycidae > Ceramiales > Ceramiaceae > Griffithsia
Accessions
- Primary accessionO36005
Subcellular Location
UniProt Annotation
GO Annotation
Plastid, chloroplast thylakoid membrane ; Peripheral membrane protein
Note: Forms the periphery of the phycobilisome rod.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000199174 | 1-164 | R-phycoerythrin alpha chain | |||
Sequence: MKSVITTTISAADAAGRFPSSSDLESIQGNIQRAAARLEAAQKLSGNHEAVVKEAGDACFAKYSYLKNAGEAGDSPEKINKCYRDIDHYMRLINYSLVVGGTGPVDEWGIAGSREVYRALNLPGSAYIAAFTFTRDRLCVPRDMSSQAGVEFTSALDYVINSLC |
Post-translational modification
Contains two covalently linked phycoerythrobilin chromophores.
Interaction
Subunit
Heterododecamer of 6 alpha and 6 beta chains. The basic functional unit of phycobiliproteins is a ring-shaped hexamer formed from two back-to-back trimers contacting via the alpha chain subunits. The trimers are composed of alpha/beta subunit heterodimers arranged around a three-fold axis of symmetry. The phycoerythrins also contain a gamma subunit which is located in the center of the hexamer.
Structure
Sequence
- Sequence statusComplete
- Length164
- Mass (Da)17,669
- Last updated1998-01-01 v1
- ChecksumEFCF110AF760201A
Keywords
- Technical term