O35857 · TIM44_MOUSE
- ProteinMitochondrial import inner membrane translocase subunit TIM44
- GeneTimm44
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids452 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner (PubMed:31618756).
Recruits mitochondrial HSP70 to drive protein translocation into the matrix using ATP as an energy source (By similarity).
Recruits mitochondrial HSP70 to drive protein translocation into the matrix using ATP as an energy source (By similarity).
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | fibrillar center | |
Cellular Component | mitochondrial inner membrane | |
Cellular Component | mitochondrial matrix | |
Cellular Component | mitochondrion | |
Cellular Component | TIM23 mitochondrial import inner membrane translocase complex | |
Molecular Function | ATP binding | |
Molecular Function | protein-folding chaperone binding | |
Biological Process | protein import into mitochondrial matrix |
Keywords
- Biological process
- Ligand
Names & Taxonomy
Protein names
- Recommended nameMitochondrial import inner membrane translocase subunit TIM44
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionO35857
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Mitochondrion inner membrane ; Peripheral membrane protein
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 282 | Abolished interaction with SLC25A4/ANT1. | ||||
Sequence: K → D |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 22 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain, transit peptide, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000034315 | ?-452 | Mitochondrial import inner membrane translocase subunit TIM44 | |||
Sequence: MAAAALRGGWCRCPRRCLGSGIQFLSSHNLPHGSSYQISRPGRELTLTKSYSSGSRKGFLSGLLDNIKQELAKNKEMKESIKKFRDEAKKLEESDALQEARRKYKSIESETVRTSEAIKKKLGELTGTVKESLDEVSKSDLGRKIKEGVEEAARTAKQSAESVSKSGEKLGKTAAFKAISQGVESVKKELDESVLGQTGPYRRPERLRKRTEFAGAKFKESKVFEANEEALGVVLHKDSKWYQQWKDFKDNNVVFNRFFEMKMKYDESDNVLIRASRALTDKVTDLLGGLFSKTEMSEVLTEILRVDPTFDKDHFLHQCETDIIPNILEAMISGELDILKDWCYEATYSQLAHPIQQAKALGFQFHSRILDISNVDLAMGKMMEQGPVLIVTFQAQVVMVIKNSKGEVYDGDPDKVQRMLYVWALCRDQEELNPYAAWRLLDISASSTEQIL | ||||||
Transit peptide | 1-? | Mitochondrion | ||||
Modified residue | 128 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 177 | N6-succinyllysine | ||||
Sequence: K | ||||||
Modified residue | 180 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 217 | N6-succinyllysine | ||||
Sequence: K |
Keywords
- PTM
Proteomic databases
2D gel databases
PTM databases
Expression
Gene expression databases
Interaction
Subunit
Probable component of the PAM complex at least composed of a mitochondrial HSP70 protein, GRPEL1 or GRPEL2, TIMM44, TIMM16/PAM16 and TIMM14/DNAJC19 (By similarity).
The complex interacts with the TIMM23 component of the TIM23 complex (PubMed:31618756).
Interacts with SLC25A4/ANT1 and SLC25A5/ANT2; leading to inhibit the presequence translocase TIMM23, thereby promoting stabilization of PINK1 (PubMed:31618756).
The complex interacts with the TIMM23 component of the TIM23 complex (PubMed:31618756).
Interacts with SLC25A4/ANT1 and SLC25A5/ANT2; leading to inhibit the presequence translocase TIMM23, thereby promoting stabilization of PINK1 (PubMed:31618756).
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length452
- Mass (Da)51,091
- Last updated2011-07-27 v2
- ChecksumDC3E5F4E43972D2F
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 5 | in Ref. 1; AAB97624 | ||||
Sequence: A → R |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U69898 EMBL· GenBank· DDBJ | AAB97624.1 EMBL· GenBank· DDBJ | mRNA | ||
CH466566 EMBL· GenBank· DDBJ | EDL21992.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC110677 EMBL· GenBank· DDBJ | AAI10678.1 EMBL· GenBank· DDBJ | mRNA | ||
BC117523 EMBL· GenBank· DDBJ | AAI17524.1 EMBL· GenBank· DDBJ | mRNA | ||
BC117524 EMBL· GenBank· DDBJ | AAI17525.1 EMBL· GenBank· DDBJ | mRNA |