O35372 · CNIH1_MOUSE
- ProteinProtein cornichon homolog 1
- GeneCnih1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids144 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score3/5
Function
function
Involved in the selective transport and maturation of TGF-alpha family proteins.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | endoplasmic reticulum membrane | |
Cellular Component | Golgi membrane | |
Biological Process | vesicle-mediated transport |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein cornichon homolog 1
- Short namesCNIH-1
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionO35372
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Endoplasmic reticulum membrane ; Multi-pass membrane protein
Note: Located primarily in the ER; may cycle between the ER and the Golgi apparatus.
Features
Showing features for topological domain, transmembrane.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Topological domain | 1-10 | Cytoplasmic | ||||
Sequence: MAFTFAAFCY | ||||||
Transmembrane | 11-31 | Helical | ||||
Sequence: MLALLLTAALIFFAIWHIIAF | ||||||
Topological domain | 32-56 | Lumenal | ||||
Sequence: DELKTDYKNPIDQCNTLNPLVLPEY | ||||||
Transmembrane | 57-77 | Helical | ||||
Sequence: LIHAFFCVMFLCAAEWLTLGL | ||||||
Topological domain | 78-122 | Cytoplasmic | ||||
Sequence: NMPLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGWCK | ||||||
Transmembrane | 123-143 | Helical | ||||
Sequence: LAFYLLAFFYYLYGMIYVLVS | ||||||
Topological domain | 144 | Lumenal | ||||
Sequence: S |
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000122223 | 1-144 | Protein cornichon homolog 1 | |||
Sequence: MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHAFFCVMFLCAAEWLTLGLNMPLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGWCKLAFYLLAFFYYLYGMIYVLVSS |
Proteomic databases
Expression
Tissue specificity
Expressed in oocytes, and at a basal level in ovarian somatic cells of 6-week-old mouse. Expressed in adult brain.
Developmental stage
Abundant in full grown oocyte and the ovulated unfertilized egg, shows a slight decrease 12 hours after fertilization. Transcripts from the activated embryonic genome are present in the eight-cell embryo.
Gene expression databases
Interaction
Subunit
Interacts with AREG immature precursor and with immature TGFA, i.e. with a prosegment and lacking full N-glycosylation, but not with the fully N-glycosylated form. In the Golgi apparatus, may form a complex with GORASP55 and transmembrane TGFA (By similarity).
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Length144
- Mass (Da)16,699
- Last updated2012-10-03 v2
- Checksum59BD114D24C455CD
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
D6RGU4 | D6RGU4_MOUSE | Cnih1 | 160 |
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 97 | in Ref. 1; AAC15828 | ||||
Sequence: G → A |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF022811 EMBL· GenBank· DDBJ | AAC15828.1 EMBL· GenBank· DDBJ | mRNA | ||
AK002293 EMBL· GenBank· DDBJ | BAB21993.1 EMBL· GenBank· DDBJ | mRNA | ||
AK011200 EMBL· GenBank· DDBJ | BAB27463.1 EMBL· GenBank· DDBJ | mRNA | ||
AK152432 EMBL· GenBank· DDBJ | BAE31214.1 EMBL· GenBank· DDBJ | mRNA | ||
AC093043 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH466605 EMBL· GenBank· DDBJ | EDL20721.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC034868 EMBL· GenBank· DDBJ | AAH34868.1 EMBL· GenBank· DDBJ | mRNA |