O23629 · H2B6_ARATH
- ProteinHistone H2B.6
- GeneH2B
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids150 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast stroma | |
Cellular Component | chloroplast thylakoid | |
Cellular Component | cytosol | |
Cellular Component | nucleolus | |
Cellular Component | nucleosome | |
Molecular Function | DNA binding | |
Molecular Function | protein heterodimerization activity | |
Molecular Function | structural constituent of chromatin |
Keywords
- Molecular function
Names & Taxonomy
Protein names
- Recommended nameHistone H2B.6
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionO23629
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
PTM/Processing
Features
Showing features for initiator methionine, modified residue, chain, cross-link.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Initiator methionine | 1 | Removed | ||||
Sequence: M | ||||||
Modified residue | 2 | N,N,N-trimethylalanine; alternate | ||||
Sequence: A | ||||||
Modified residue | 2 | N,N-dimethylalanine; alternate | ||||
Sequence: A | ||||||
Modified residue | 2 | N-methylalanine; alternate | ||||
Sequence: A | ||||||
Chain | PRO_0000238693 | 2-150 | Histone H2B.6 | |||
Sequence: APRAEKKPAEKKPAAEKPVEEKSKAEKAPAEKKPKAGKKLPKEAGAGGDKKKKMKKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLASESSKLARYNKKPTITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS | ||||||
Modified residue | 7 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 12 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 13 | N6,N6-dimethyllysine | ||||
Sequence: K | ||||||
Modified residue | 28 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 33 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 39 | N6-acetyllysine | ||||
Sequence: K | ||||||
Modified residue | 40 | N6-acetyllysine; partial | ||||
Sequence: K | ||||||
Cross-link | 146 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) | ||||
Sequence: K |
Post-translational modification
Mono-, di- or trimethylated at the N-terminus to form H2BA1me1/2/3. H2BA1me2 may be acetylated to form H2BA1me2K6ac and H2BA1me2K6acK11ac.
Monoubiquitinated by BRE1 to form H2BK143ub1 and deubiquitinated by UBP26. Required for heterochromatic histone H3 di- and trimethylation at H3K4me. May give a specific tag for epigenetic transcriptional activation.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-58 | Disordered | ||||
Sequence: MAPRAEKKPAEKKPAAEKPVEEKSKAEKAPAEKKPKAGKKLPKEAGAGGDKKKKMKKK |
Sequence similarities
Belongs to the histone H2B family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length150
- Mass (Da)16,436
- Last updated2007-01-23 v3
- ChecksumE7693DD90DEB994B
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Y12576 EMBL· GenBank· DDBJ | CAA73156.1 EMBL· GenBank· DDBJ | mRNA | ||
AL162459 EMBL· GenBank· DDBJ | CAB82822.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | AEE78097.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BT006400 EMBL· GenBank· DDBJ | AAP21208.1 EMBL· GenBank· DDBJ | mRNA | ||
AY087219 EMBL· GenBank· DDBJ | AAM64775.1 EMBL· GenBank· DDBJ | mRNA |