O23145 · KSG2_ARATH
- ProteinShaggy-related protein kinase beta
- GeneASK2
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids431 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
May mediate extracellular signals to regulate transcription in differentiating cells.
Catalytic activity
- ATP + L-seryl-[protein] = ADP + H+ + O-phospho-L-seryl-[protein]
Features
Showing features for binding site, active site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | nucleus | |
Molecular Function | ATP binding | |
Molecular Function | protein serine kinase activity | |
Molecular Function | protein serine/threonine kinase activity | |
Biological Process | cell differentiation | |
Biological Process | signal transduction |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameShaggy-related protein kinase beta
- EC number
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionO23145
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
PTM/Processing
Features
Showing features for chain, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000086217 | 1-431 | Shaggy-related protein kinase beta | |||
Sequence: MNVVRRLTSIASGRNFVSSDNVGETETPRSKPNQNREETESTETTSYEKDSVSSSENSDHLPKEIREDMDCGIIKGNGTESGRIITTKKKGLNDQKDKTISYRAEHVIGTGSFGVVFQAKCLETEEKVAIKKVLQDKRYKNRELQIMRMLDHPNVVELKHSFFSTTEKDELYLNLVLEYVPETIYRASRSYTKMNQHMPLIYIQLYTYQICRAMNYLHQVVGVCHRDIKPQNLLVNNVTHEVKICDFGSAKMLIPGEPNISYICSRYYRAPELIFGATEYTSAIDMWSVGCVMAELFLGHPLFPGETSVDQLVEIIKILGTPAREEIKNMNPRYNDFKFPQIKAQPWHKIFRRQVSPEAMDLASRLLQYSPNLRCTALEACAHPFFDDLRDPRASLPNGRALPPLFDFTAQELAGASVELRHRLIPEHARK | ||||||
Modified residue | 262 | Phosphotyrosine | ||||
Sequence: Y |
Post-translational modification
Autophosphorylated mainly on threonine and serine residues.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 12-29 | Polar residues | ||||
Sequence: SGRNFVSSDNVGETETPR | ||||||
Region | 12-65 | Disordered | ||||
Sequence: SGRNFVSSDNVGETETPRSKPNQNREETESTETTSYEKDSVSSSENSDHLPKEI | ||||||
Compositional bias | 30-45 | Basic and acidic residues | ||||
Sequence: SKPNQNREETESTETT | ||||||
Domain | 102-386 | Protein kinase | ||||
Sequence: YRAEHVIGTGSFGVVFQAKCLETEEKVAIKKVLQDKRYKNRELQIMRMLDHPNVVELKHSFFSTTEKDELYLNLVLEYVPETIYRASRSYTKMNQHMPLIYIQLYTYQICRAMNYLHQVVGVCHRDIKPQNLLVNNVTHEVKICDFGSAKMLIPGEPNISYICSRYYRAPELIFGATEYTSAIDMWSVGCVMAELFLGHPLFPGETSVDQLVEIIKILGTPAREEIKNMNPRYNDFKFPQIKAQPWHKIFRRQVSPEAMDLASRLLQYSPNLRCTALEACAHPFF |
Sequence similarities
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
This entry describes 1 isoforms produced by Alternative splicing. A number of isoforms are produced. According to EST sequences.
O23145-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length431
- Mass (Da)49,313
- Last updated1998-01-01 v1
- Checksum1FB3E6BE19BA8AD0
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
F4JE58 | F4JE58_ARATH | At3g61160 | 438 | ||
A0A1I9LQI5 | A0A1I9LQI5_ARATH | At3g61160 | 421 | ||
A0A1I9LQI6 | A0A1I9LQI6_ARATH | At3g61160 | 384 | ||
A0A1I9LQI7 | A0A1I9LQI7_ARATH | At3g61160 | 359 | ||
A0A1I9LQI4 | A0A1I9LQI4_ARATH | At3g61160 | 352 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 12-29 | Polar residues | ||||
Sequence: SGRNFVSSDNVGETETPR | ||||||
Compositional bias | 30-45 | Basic and acidic residues | ||||
Sequence: SKPNQNREETESTETT |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AJ002280 EMBL· GenBank· DDBJ | CAA05292.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ224338 EMBL· GenBank· DDBJ | CAA11903.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
AL137898 EMBL· GenBank· DDBJ | CAB71046.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002686 EMBL· GenBank· DDBJ | AEE80162.1 EMBL· GenBank· DDBJ | Genomic DNA |