O22396 · O22396_9CHLO
- ProteinProliferating cell nuclear antigen
- GenePCNA
- StatusUniProtKB unreviewed (TrEMBL)
- Organism
- Amino acids205 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score2/5
Function
function
This protein is an auxiliary protein of DNA polymerase delta and is involved in the control of eukaryotic DNA replication by increasing the polymerase's processibility during elongation of the leading strand.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | PCNA complex | |
Molecular Function | DNA binding | |
Molecular Function | DNA polymerase processivity factor activity | |
Biological Process | leading strand elongation | |
Biological Process | mismatch repair | |
Biological Process | regulation of DNA replication | |
Biological Process | translesion synthesis |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameProliferating cell nuclear antigen
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Chlorophyta > core chlorophytes > Chlorodendrophyceae > Chlorodendrales > Chlorodendraceae > Tetraselmis
Accessions
- Primary accessionO22396
Subcellular Location
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-70 | Proliferating cell nuclear antigen PCNA N-terminal | ||||
Sequence: EGFEHYRCDRSLSMGLNLGNMAKMLKCAGNDDVITIKADDKPDSLTFMMESPSQDRVSDFELKLMDIDSE | ||||||
Domain | 73-200 | Proliferating cell nuclear antigen PCNA C-terminal | ||||
Sequence: GIPETEHQAVVKLPASEFQRICRDLSSIGDTVNISVTKDGVRFSTKGDIGSANISCRQNTSVDKPEEAVVIEMQEPVTLTFALRYLNSFAKATPLSSTVTLSMSKELPIVVEYRIQDMGFVKFYLAPK |
Sequence similarities
Belongs to the PCNA family.
Family and domain databases
Sequence
- Sequence statusFragment
- Length205
- Mass (Da)22,854
- Last updated1998-01-01 v1
- Checksum9FCF1609319ABF5E
Features
Showing features for non-terminal residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Non-terminal residue | 1 | |||||
Sequence: E | ||||||
Non-terminal residue | 205 | |||||
Sequence: E |