O22265 · SR43C_ARATH
- ProteinSignal recognition particle 43 kDa protein, chloroplastic
- GeneCAO
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids373 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Component of the chloroplast signal recognition particle pathway. Required for post-translational targeting of proteins into the thylakoid membrane but seems to be dispensable for co-translational targeting with a translating ribosome present. May be able to function independently of cpFTSY and FFC/cpSRP54 in targeting LHCPs to the thylakoids. Acts as a highly specific chaperone for LHCPs, preventing aggregation and being able to dissolve aggregates.
Miscellaneous
Unlike eukaryotic or prokaryotic signal recognition particle (SRP), the chloroplast SRP from higher plants lacks an SRP-RNA component. It targets both chloroplast-encoded and nucleus-encoded substrates to the thylakoid membrane, post-translationally for the nucleus-encoded proteins and co-translationally for the chloroplast-encoded proteins.
Features
Showing features for binding site.
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chloroplast | |
Cellular Component | chloroplast envelope | |
Cellular Component | chloroplast stroma | |
Cellular Component | chloroplast thylakoid membrane | |
Cellular Component | cytosol | |
Cellular Component | protein-containing complex | |
Cellular Component | signal recognition particle, endoplasmic reticulum targeting | |
Molecular Function | disordered domain specific binding | |
Molecular Function | identical protein binding | |
Molecular Function | metal ion binding | |
Molecular Function | protein domain specific binding | |
Molecular Function | protein-macromolecule adaptor activity | |
Biological Process | protein heterotrimerization | |
Biological Process | protein import into chloroplast thylakoid membrane | |
Biological Process | response to high light intensity |
Keywords
- Molecular function
- Ligand
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameSignal recognition particle 43 kDa protein, chloroplastic
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionO22265
- Secondary accessions
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Plants show a reduced level of the major light-harvesting chlorophyll a/b-binding proteins (LHCPs).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 161 | Decreased interaction with LHCP. | ||||
Sequence: R → A | ||||||
Mutagenesis | 192 | Decreased interaction with LHCP. | ||||
Sequence: R → A | ||||||
Mutagenesis | 204 | Loss of interaction with LHCP. | ||||
Sequence: Y → A | ||||||
Mutagenesis | 226 | Decreased interaction with LHCP. | ||||
Sequence: R → A | ||||||
Mutagenesis | 269 | Decreased interaction with ALB3. | ||||
Sequence: Y → A | ||||||
Mutagenesis | 291 | Decreased interaction with ALB3. | ||||
Sequence: W → A | ||||||
Mutagenesis | 293 | Decreased interaction with ALB3. | ||||
Sequence: D → A |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 29 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for transit peptide, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Transit peptide | 1-56 | Chloroplast | ||||
Sequence: MQKVFLAMDTCALVIHQSLSRIKLSPPKSSSSSSSAFSPESLPIRRIELCFRGAIC | ||||||
Chain | PRO_0000238461 | 57-373 | Signal recognition particle 43 kDa protein, chloroplastic | |||
Sequence: AAVQRNYEETTSSVEEAEEDDESSSSYGEVNKIIGSRTAGEGAMEYLIEWKDGHSPSWVPSSYIAADVVSEYETPWWTAARKADEQALSQLLEDRDVDAVDENGRTALLFVAGLGSDKCVRLLAEAGADLDHRDMRGGLTALHMAAGYVRPEVVEALVELGADIEVEDERGLTALELAREILKTTPKGNPMQFGRRIGLEKVINVLEGQVFEYAEVDEIVEKRGKGKDVEYLVRWKDGGDCEWVKGVHVAEDVAKDYEDGLEYAVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQQPMNE |
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Homodimer. Component of the cpSRP complex, composed of a FFC/cpSRP54 monomer and a CAO/cpSRP43 dimer. Interacts (via chromo domains 2 and 3) with ALB3 (via C-terminus), but not with ALB3L1/ALB4. Can interact simultaneously with ALB3 and FFC/cpSRP54. Interacts with LHCP and LTD.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
XENO | O22265 | AB80 P07371 | 7 | EBI-780656, EBI-2353186 | |
BINARY | O22265 | ALB3 Q8LBP4 | 10 | EBI-780656, EBI-1806831 | |
XENO | O22265 | CAB8 P27490 | 4 | EBI-780656, EBI-8295162 | |
BINARY | O22265 | CAO O22265 | 5 | EBI-780656, EBI-780656 | |
BINARY | O22265 | FFC P37107 | 21 | EBI-780656, EBI-780642 | |
BINARY | O22265 | GATA28 Q8H1G0 | 4 | EBI-780656, EBI-4435064 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for coiled coil, region, domain, repeat.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Coiled coil | 57-79 | |||||
Sequence: AAVQRNYEETTSSVEEAEEDDES | ||||||
Region | 65-85 | Disordered | ||||
Sequence: ETTSSVEEAEEDDESSSSYGE | ||||||
Domain | 84-135 | Chromo 1 | ||||
Sequence: GEVNKIIGSRTAGEGAMEYLIEWKDGHSPSWVPSSYIAADVVSEYETPWWTA | ||||||
Repeat | 136-158 | ANK 1 | ||||
Sequence: ARKADEQALSQLLEDRDVDAVDE | ||||||
Repeat | 159-188 | ANK 2 | ||||
Sequence: NGRTALLFVAGLGSDKCVRLLAEAGADLDH | ||||||
Repeat | 193-222 | ANK 3 | ||||
Sequence: GGLTALHMAAGYVRPEVVEALVELGADIEV | ||||||
Repeat | 242-269 | ANK 4 | ||||
Sequence: PKGNPMQFGRRIGLEKVINVLEGQVFEY | ||||||
Domain | 270-320 | Chromo 2 | ||||
Sequence: AEVDEIVEKRGKGKDVEYLVRWKDGGDCEWVKGVHVAEDVAKDYEDGLEYA | ||||||
Domain | 321-373 | Chromo 3 | ||||
Sequence: VAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQQPMNE |
Domain
The binding to LHCP occurs through the first ankyrin repeat and the L18 domain of LHCP.
Homodimerization occurs through both the third and the fourth ankyrin repeats.
Chromo domain 1 may act as a negative regulator of GTP hydrolysis by FFC/cpSRP54. It is unnecessary for targeting complex formation but is required for integration into the thylakoid membrane.
Chromo domain 2 is involved in binding to the M domain of FFC/cpSRP54.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length373
- Mass (Da)41,279
- Last updated2002-06-01 v2
- ChecksumF75ED9C7046A1441
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 35 | in Ref. 1; AAD01509 | ||||
Sequence: S → SSSS | ||||||
Sequence conflict | 73 | in Ref. 4; AAK96775/AAN72202 | ||||
Sequence: A → V | ||||||
Sequence conflict | 137 | in Ref. 1; AAD01509 | ||||
Sequence: R → K |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF013115 EMBL· GenBank· DDBJ | AAD01509.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AC002535 EMBL· GenBank· DDBJ | AAC62865.2 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC10842.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY050442 EMBL· GenBank· DDBJ | AAK91457.1 EMBL· GenBank· DDBJ | mRNA | ||
AY054584 EMBL· GenBank· DDBJ | AAK96775.1 EMBL· GenBank· DDBJ | mRNA | ||
AY057532 EMBL· GenBank· DDBJ | AAL09772.1 EMBL· GenBank· DDBJ | mRNA | ||
AY133540 EMBL· GenBank· DDBJ | AAM91370.1 EMBL· GenBank· DDBJ | mRNA | ||
BT002191 EMBL· GenBank· DDBJ | AAN72202.1 EMBL· GenBank· DDBJ | mRNA |