O22133 · BEN1_ARATH
- ProteinProtein BRI1-5 ENHANCED 1
- GeneBEN1
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids364 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Element of the brassinosteroid metabolic pathway that regulates typhasterol (TY), castasterone (CS) and brassinolide (BL) levels (PubMed:17521414).
Involved in the control of organ elongation (PubMed:17521414, PubMed:23893742).
Involved in the control of organ elongation (PubMed:17521414, PubMed:23893742).
Miscellaneous
The ben1-1D (bri1-5 enhanced 1-1dominant) activation-tagging mutant suppresses the bri1-5 weak mutant allele of the brassinosteroid receptor gene BRI1.
Pathway
Plant hormone biosynthesis; brassinosteroid biosynthesis.
Features
Showing features for binding site, active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 44-49 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: GGSGFV | ||||||
Binding site | 69 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 98-99 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: DL | ||||||
Binding site | 202 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: Y | ||||||
Active site | 206 | Proton donor | ||||
Sequence: K | ||||||
Binding site | 206 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: K | ||||||
Binding site | 232 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: V | ||||||
Binding site | 244 | NADP+ (UniProtKB | ChEBI) | ||||
Sequence: S |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Molecular Function | oxidoreductase activity | |
Biological Process | brassinosteroid biosynthetic process | |
Biological Process | brassinosteroid metabolic process | |
Biological Process | regulation of brassinosteroid biosynthetic process | |
Biological Process | response to absence of light |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein BRI1-5 ENHANCED 1
- EC number
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionO22133
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Disruption phenotype
Abnormal organs elongation leading to long inflorescences, leaves and petioles, especially in the light.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 19 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000434413 | 1-364 | Protein BRI1-5 ENHANCED 1 | |||
Sequence: MVREEQEEDDNNNNNNGGGERKLLVADETVPSLLDETGLVCVTGGSGFVASWLIMRLLQRGYSVRATVRTNSEGNKKDISYLTELPFASERLQIFTADLNEPESFKPAIEGCKAVFHVAHPMDPNSNETEETVTKRTVQGLMGILKSCLDAKTVKRFFYTSSAVTVFYSGGNGGGGGEVDESVWSDVEVFRNQKEKRVSSSYVVSKMAAETAALEFGGKNGLEVVTLVIPLVVGPFISSSLPSSVFISLAMLFGNYKEKYLFDTYNMVHIDDVARAMIFLLEKPVAKGRYICSSVEMKIDEVFEFLSTKFPQFQLPSIDLNKYKVEKRMGLSSKKLKSAGFEFKYGAEEIFSGAIRSCQARGFL |
Proteomic databases
Expression
Tissue specificity
Mainly present in cell elongating-containing tissues. Strongly expressed in roots and flowers, also observed in petioles, stems, leaves and siliques.
Induction
Down-regulated in the dark.
Developmental stage
First observed after seed germination, mainly in the root cap, and in elongation and maturation zones, and, to a lower extent, in the apical meristem zone. Later present in roots, with higher levels in light conditions than in darkness. Weak levels in young flowers. Progressive accumulation in developing siliques, at both ends. In rosette leaves, mainly localized in vascular tissues and hydathodes.
Gene expression databases
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-22 | Disordered | ||||
Sequence: MVREEQEEDDNNNNNNGGGERK |
Sequence similarities
Belongs to the NAD(P)-dependent epimerase/dehydratase family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length364
- Mass (Da)40,261
- Last updated1998-01-01 v1
- Checksum03B2AD3D437A1037
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A1P8AYJ1 | A0A1P8AYJ1_ARATH | BEN1 | 307 | ||
A0A1P8AYJ2 | A0A1P8AYJ2_ARATH | BEN1 | 255 | ||
A0A1P8AYD5 | A0A1P8AYD5_ARATH | BEN1 | 324 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC002387 EMBL· GenBank· DDBJ | AAB82624.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC10546.1 EMBL· GenBank· DDBJ | Genomic DNA |