O19116 · SFRP1_BOVIN
- ProteinSecreted frizzled-related protein 1
- GeneSFRP1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids308 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP1 decreases intracellular beta-catenin levels (By similarity).
Has antiproliferative effects on vascular cells, in vitro and in vivo, and can induce, in vivo, an angiogenic response. In vascular cell cycle, delays the G1 phase and entry into the S phase (By similarity).
In kidney development, inhibits tubule formation and bud growth in metanephroi (By similarity).
Inhibits WNT1/WNT4-mediated TCF-dependent transcription
Has antiproliferative effects on vascular cells, in vitro and in vivo, and can induce, in vivo, an angiogenic response. In vascular cell cycle, delays the G1 phase and entry into the S phase (By similarity).
In kidney development, inhibits tubule formation and bud growth in metanephroi (By similarity).
Inhibits WNT1/WNT4-mediated TCF-dependent transcription
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular space | |
Cellular Component | plasma membrane | |
Molecular Function | frizzled binding | |
Molecular Function | Wnt-protein binding | |
Biological Process | actin cytoskeleton organization | |
Biological Process | canonical Wnt signaling pathway | |
Biological Process | cell differentiation | |
Biological Process | non-canonical Wnt signaling pathway | |
Biological Process | positive regulation of cell-matrix adhesion | |
Biological Process | positive regulation of focal adhesion assembly | |
Biological Process | positive regulation of GTPase activity | |
Biological Process | positive regulation of stress fiber assembly | |
Biological Process | regulation of angiogenesis | |
Biological Process | substrate adhesion-dependent cell spreading |
Keywords
- Molecular function
- Biological process
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameSecreted frizzled-related protein 1
- Short namessFRP-1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Laurasiatheria > Artiodactyla > Ruminantia > Pecora > Bovidae > Bovinae > Bos
Accessions
- Primary accessionO19116
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Cell membrane or extracellular matrix-associated. Released by heparin-binding.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-25 | |||||
Sequence: MGGGRWAAAGALLALAAGLLAAGSA | ||||||
Chain | PRO_0000032537 | 26-308 | Secreted frizzled-related protein 1 | |||
Sequence: SEYDYVSFQSDIGAYQSGRFYTKPPQCVDIPADLRLCHNVGYKRMVLPNLLEHETMAEVKQQASSWVPLLNKNCHIGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKELKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKTFMKKMKNHECPTFQSVFK | ||||||
Disulfide bond | 52↔115 | |||||
Sequence: CVDIPADLRLCHNVGYKRMVLPNLLEHETMAEVKQQASSWVPLLNKNCHIGTQVFLCSLFAPVC | ||||||
Disulfide bond | 62↔108 | |||||
Sequence: CHNVGYKRMVLPNLLEHETMAEVKQQASSWVPLLNKNCHIGTQVFLC | ||||||
Disulfide bond | 99↔134 | |||||
Sequence: CHIGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSC | ||||||
Disulfide bond | 123↔160 | |||||
Sequence: CRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVC | ||||||
Disulfide bond | 127↔151 | |||||
Sequence: CEAVRDSCEPVMQFFGFYWPEMLKC | ||||||
Glycosylation | 167 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 180↔250 | |||||
Sequence: CPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKELKKLVLYLKNGADC | ||||||
Disulfide bond | 183↔252 | |||||
Sequence: CDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKELKKLVLYLKNGADCPC | ||||||
Disulfide bond | 197↔300 | |||||
Sequence: CASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKELKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKTFMKKMKNHEC |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Highest levels in aortic endothelium, heart, spleen and eye. Lower levels in lung, brain and kidney. Weak expression in liver, skeletal muscle and the medial layer of the aorta. In the cortical brain, localized to neurons and small blood vessels. In the retina, localized to the inner and outer nuclear layers with high expression in the neuronal cell bodies. In the heart, restricted to myocytes. In lung, highest expression found in the epithelium of terminal bronchioles. In kidney, localized to the epithelium of collecting ducts of the medulla and, in spleen, expression restricted to the red pulp in cells associated with the sinuses.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 47-163 | FZ | ||||
Sequence: TKPPQCVDIPADLRLCHNVGYKRMVLPNLLEHETMAEVKQQASSWVPLLNKNCHIGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAM | ||||||
Domain | 180-300 | NTR | ||||
Sequence: CPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKELKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKTFMKKMKNHEC |
Domain
The FZ domain is involved in binding with Wnt ligands.
Sequence similarities
Belongs to the secreted frizzled-related protein (sFRP) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length308
- Mass (Da)34,763
- Last updated1998-01-01 v1
- Checksum184D138B31123FEB
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U85945 EMBL· GenBank· DDBJ | AAB67062.1 EMBL· GenBank· DDBJ | mRNA |