O17898 · NHR60_CAEEL
- ProteinNuclear hormone receptor family member nhr-60
- Genenhr-60
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids443 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Orphan nuclear receptor (Potential). Required for embryonic and larval morphogenesis and probably for seam cell positioning and migration.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 44-121 | Nuclear receptor | ||||
Sequence: PTECLICGNSANGHHYDVASCNGCKTFFRRMCVSDRSFECKAKGDCFDLTKRKVPLKCRACRHQKCISVGMNPLAMEV |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nuclear envelope | |
Molecular Function | nuclear receptor activity | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Molecular Function | zinc ion binding | |
Biological Process | cell differentiation | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameNuclear hormone receptor family member nhr-60
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionO17898
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Localized in the nucleus from the one-cell stage of development onwards. Localizes to the nuclear periphery of all cells.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown results in arrest at the two-fold stage of embryogenesis in the majority of embryos. These embryos have incomplete ventral closure and morphological defects including elongation defects, and either absent or irregularly placed seam cells in the head and tail regions. Surviving larvae also exhibit morphological defects and contain vacuoles.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000437683 | 1-443 | Nuclear hormone receptor family member nhr-60 | |||
Sequence: MIQSSSSISQDSLDLPSILSTFSADEPEDEPSPTAVKSTKPQRPTECLICGNSANGHHYDVASCNGCKTFFRRMCVSDRSFECKAKGDCFDLTKRKVPLKCRACRHQKCISVGMNPLAMEVDEKAASSSNFKKLVKRAQDLEPDDDCQVTAVVNKMQIVKPVDSIESKMQNITDMLVYLETKVERFRKSAYNPHWNEFSGLEYLLESECRIGFGDRFGPMPGWPLRRDQLGPPRLPKPPSPGKPRDSQHSQNIKQWFFYNLLTTVEYAKTFMFFHRLSSRDKLILTRHVALACTNLHISYSSIRRNLEVIIEPDGSEPMTFNDTHYSASVMSVAPLIRCQIKNIEYLLLKAIVLCNPAVPDLSAKSQEIISLERVKYADALFNYCLRSRSDGPPHFAQLIQIIDVLERQQRMQKDLHLLLVAPKVAKLPKDLVMRVIEDIMDS |
Proteomic databases
Expression
Developmental stage
Expressed from embryogenesis onwards with high expression during the larval stages of development, peaking at the L3 stage and decreasing at the L4 stage of larval development. Ubiquitously expressed, but expression in seam cells begins in embryonic precursors soon after fertilization and is most prominent in larval stages of development. Expression is also prominent in the germ line during the L1 stage of larval development. Also expressed in pharyngeal gland cells, VC4 and VC5 neurons, and in the hermaphrodite uterine vulval uv1 cells.
Gene expression databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, zinc finger, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-19 | Polar residues | ||||
Sequence: MIQSSSSISQDSLDLPSIL | ||||||
Region | 1-40 | Disordered | ||||
Sequence: MIQSSSSISQDSLDLPSILSTFSADEPEDEPSPTAVKSTK | ||||||
Zinc finger | 47-67 | NR C4-type | ||||
Sequence: CLICGNSANGHHYDVASCNGC | ||||||
Zinc finger | 83-104 | NR C4-type | ||||
Sequence: CKAKGDCFDLTKRKVPLKCRAC | ||||||
Domain | 196-439 | NR LBD | ||||
Sequence: NEFSGLEYLLESECRIGFGDRFGPMPGWPLRRDQLGPPRLPKPPSPGKPRDSQHSQNIKQWFFYNLLTTVEYAKTFMFFHRLSSRDKLILTRHVALACTNLHISYSSIRRNLEVIIEPDGSEPMTFNDTHYSASVMSVAPLIRCQIKNIEYLLLKAIVLCNPAVPDLSAKSQEIISLERVKYADALFNYCLRSRSDGPPHFAQLIQIIDVLERQQRMQKDLHLLLVAPKVAKLPKDLVMRVIED | ||||||
Region | 225-249 | Disordered | ||||
Sequence: LRRDQLGPPRLPKPPSPGKPRDSQH |
Sequence similarities
Belongs to the nuclear hormone receptor family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length443
- Mass (Da)50,309
- Last updated1998-01-01 v1
- ChecksumAA65D149CCA931A6
Features
Showing features for compositional bias, sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-19 | Polar residues | ||||
Sequence: MIQSSSSISQDSLDLPSIL | ||||||
Sequence conflict | 322 | in Ref. 3; AAG15157 | ||||
Sequence: N → S |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF273808 EMBL· GenBank· DDBJ | AAG15157.1 EMBL· GenBank· DDBJ | mRNA | ||
BX284605 EMBL· GenBank· DDBJ | CAB09422.1 EMBL· GenBank· DDBJ | Genomic DNA |