O17608 · SLFL1_CAEEL
- ProteinSchlafen-like protein 1
- Genetofu-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids373 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score4/5
Function
function
Component of the trimeric PUCH (precursor of 21U RNA 5'-end cleavage holoenzyme) complex, that acts as an endoribonuclease processing the 5'-end of precursor Piwi-interacting RNAs (piRNAs) (PubMed:37758951).
The PUCH complex consists of tofu-1, tofu-2 and either slfl-3 or slfl-4, with tofu-2 exhibiting endoribonuclease activity (PubMed:37758951).
PUCH-mediated processing strictly requires a 7-methyl-G cap (m7 G-cap) and an uracil at position three (U3) (PubMed:37758951).
PUCH also exhibits a strict bias for piRNA precursors with an A or G at position 1 (PubMed:37758951).
Mature piRNA production is enhanced by the interaction of PUCH with the PETISCO complex, which is stabilizing piRNA precursors and allows their processing by PUCH (PubMed:37758951).
The PUCH complex consists of tofu-1, tofu-2 and either slfl-3 or slfl-4, with tofu-2 exhibiting endoribonuclease activity (PubMed:37758951).
PUCH-mediated processing strictly requires a 7-methyl-G cap (m7 G-cap) and an uracil at position three (U3) (PubMed:37758951).
PUCH also exhibits a strict bias for piRNA precursors with an A or G at position 1 (PubMed:37758951).
Mature piRNA production is enhanced by the interaction of PUCH with the PETISCO complex, which is stabilizing piRNA precursors and allows their processing by PUCH (PubMed:37758951).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | endoribonuclease complex | |
Biological Process | primary piRNA processing |
Names & Taxonomy
Protein names
- Recommended nameSchlafen-like protein 1
- Short namesSLFL-1 ; SLFN-like 1
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionO17608
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000452467 | 1-373 | Schlafen-like protein 1 | |||
Sequence: MAALFEENDSYSDSENEEDFSGFLSEIEENENEDEFENDDEFEDDDELENVDELEDDELSSEEVDIPSENEVIVELHDGQAEVEESLLDALLGKALAGDQMNSRIEGLFEDLDSSVEPDIIDRSELEDVDSGISVGAVSSSSAETQASDAKCKNKDAFDMSSLKKYMQYITEEEHAVSVEDIPDFASKKNVYGTSFNVRNGIMSRPPRFEFARHDQRWIDSCVSMAYEKDKTLKELITLGKLTTTVKAGAKIEFRTKFTDVHIRSADEINLMETHDIQQIIRDALNSKRLAVVLFGIGKDGKVTGCHMGPGQQDNLRLALDTAVQTEFAPPIENILDVVDMNFVPVEEMDETFLIVIRVKQLRNQVYRLESSV |
Proteomic databases
Expression
Interaction
Subunit
Component of the trimeric PUCH (precursor of 21U RNA 5'-end cleavage holoenzyme) complex; consisting of tofu-1, tofu-2 and either slfl-3 or slfl-4; which is required for processing of piRNA precursors (PubMed:37758951).
Within the complex, interacts (via N-terminus) with tofu-2 (via N-terminus); the interaction stabilizes tofu-2 and may form a functional nuclease (PubMed:37758951).
Within the complex, required for the interaction of tofu-2 (via N-terminus) with slfl-3 (via N-terminus) (PubMed:37758951).
Interacts (via residues 82-172) with the PETISCO complex subunit tofu-6 (via residues 120-314); the interaction between the PETISCO and PUCH complex members enhances piRNA production in vivo (PubMed:37758951).
Within the complex, interacts (via N-terminus) with tofu-2 (via N-terminus); the interaction stabilizes tofu-2 and may form a functional nuclease (PubMed:37758951).
Within the complex, required for the interaction of tofu-2 (via N-terminus) with slfl-3 (via N-terminus) (PubMed:37758951).
Interacts (via residues 82-172) with the PETISCO complex subunit tofu-6 (via residues 120-314); the interaction between the PETISCO and PUCH complex members enhances piRNA production in vivo (PubMed:37758951).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-67 | Disordered | ||||
Sequence: MAALFEENDSYSDSENEEDFSGFLSEIEENENEDEFENDDEFEDDDELENVDELEDDELSSEEVDIP | ||||||
Compositional bias | 10-67 | Acidic residues | ||||
Sequence: SYSDSENEEDFSGFLSEIEENENEDEFENDDEFEDDDELENVDELEDDELSSEEVDIP | ||||||
Region | 247-373 | SLFN-like fold | ||||
Sequence: KAGAKIEFRTKFTDVHIRSADEINLMETHDIQQIIRDALNSKRLAVVLFGIGKDGKVTGCHMGPGQQDNLRLALDTAVQTEFAPPIENILDVVDMNFVPVEEMDETFLIVIRVKQLRNQVYRLESSV |
Domain
In mammalian Schlafen proteins, two SLFN-folds come together to form the nuclease domain. In tofu-1 and tofu-2, only one SLFN-like fold can be identified, suggesting that the two proteins may interact via their SLFN-like folds to form a functional nuclease.
Sequence similarities
Belongs to the Schlafen family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length373
- Mass (Da)41,984
- Last updated2008-02-05 v3
- Checksum2E2C003672F0FD5B
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 10-67 | Acidic residues | ||||
Sequence: SYSDSENEEDFSGFLSEIEENENEDEFENDDEFEDDDELENVDELEDDELSSEEVDIP |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX284605 EMBL· GenBank· DDBJ | CAB02794.3 EMBL· GenBank· DDBJ | Genomic DNA |