O16956 · LIPL3_CAEEL
- ProteinLipase lipl-3
- Genelipl-3
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids404 (go to sequence)
- Protein existenceEvidence at transcript level
- Annotation score4/5
Function
function
Lipase that, together with lipl-1, plays a role in the response to nutrient deprivation by controlling lipid metabolism (PubMed:23604316).
Specifically, involved in the breakdown of lipids during lipophagy, a process during which lipids contained in lipid droplets that have been delivered to lysosomes by autophagy are degraded (PubMed:23604316).
Specifically, involved in the breakdown of lipids during lipophagy, a process during which lipids contained in lipid droplets that have been delivered to lysosomes by autophagy are degraded (PubMed:23604316).
pH Dependence
Optimum pH is acidic.
Features
Showing features for active site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Active site | 168 | Nucleophile | ||||
Sequence: S | ||||||
Active site | 344 | Charge relay system | ||||
Sequence: D | ||||||
Active site | 376 | Charge relay system | ||||
Sequence: H |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | lysosomal lumen | |
Cellular Component | lysosome | |
Molecular Function | hydrolase activity, acting on ester bonds | |
Biological Process | lipid catabolic process |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Protein family/group databases
Names & Taxonomy
Protein names
- Recommended nameLipase lipl-3
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionO16956
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Secreted into the intestinal lumen.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain, glycosylation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MCSSLCALLLVILAVHNVHA | ||||||
Chain | PRO_5004157979 | 21-404 | Lipase lipl-3 | |||
Sequence: KSDPELHMTTPQIIERWGYPAMIYSVTTDDGYILELHRIPHGKTNVTWPNGKQPVVFMQHGLLCASTDWTMNLPEQSAAFIFADAGFDVWLGNMRGNTYSMKHKNLKASHSDFWEWSWDEMATYDLPAMIDKVLEVTGQESLYYMGHSQGTLTMFSHLSKDDGIFAKKIKKFFALAPVGSVKDIKGFLSFFAHYFSLEFDGWFDVFGAGEFLPNNWAMKLAAKDICGGLKIESDLCDNVCFLIAGPESDQWNSTRVPVYASHDPAGTATQNIVHWIQMVRHGGVPAYDWGSKENKKKYGQANPPEYDFTAIKGTQIYLYWSDADWLADKTDITNYLLTRLNPAIIAQNNYFTDYNHFDFVFGLRAPNDIYLPIVDICTKDYNGK | ||||||
Glycosylation | 65 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Glycosylation | 272 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N |
Keywords
- PTM
Proteomic databases
PTM databases
Interaction
Protein-protein interaction databases
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length404
- Mass (Da)45,779
- Last updated2001-10-01 v2
- ChecksumA87561AE0B2FED46
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX284605 EMBL· GenBank· DDBJ | CCD64488.1 EMBL· GenBank· DDBJ | Genomic DNA |