O15945 · ARNT_DROME
- ProteinAryl hydrocarbon receptor nuclear translocator homolog
- Genetgo
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids642 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Heterodimers of tgo/trh are involved in the control of breathless expression. Plays a role in the cellular or tissue response to oxygen deprivation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAryl hydrocarbon receptor nuclear translocator homolog
- Short namesdARNT
- Alternative names
Gene names
Organism names
- Strains
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Arthropoda > Hexapoda > Insecta > Pterygota > Neoptera > Endopterygota > Diptera > Brachycera > Muscomorpha > Ephydroidea > Drosophilidae > Drosophila > Sophophora
Accessions
- Primary accessionO15945
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000127117 | 1-642 | Aryl hydrocarbon receptor nuclear translocator homolog | |||
Sequence: MDEANIQDKERFASRENHCEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKALRGTGNTSSDGTYKPSFLTDQELKHLILEAADGFLFVVSCDSGRVIYVSDSVTPVLNYTQSDWYGTSLYEHIHPDDREKIREQLSTQESQNAGRILDLKSGTVKKEGHQSSMRLSMGARRGFICRMRVGNVNPESMVSGHLNRLKQRNSLGPSRDGTNYAVVHCTGYIKNWPPTDMFPNMHMERDVDDMSSHCCLVAIGRLQVTSTAANDMSGSNNQSEFITRHAMDGKFTFVDQRVLNILGYTPTELLGKICYDFFHPEDQSHMKESFDQVLKQKGQMFSLLYRARAKNSEYVWLRTQAYAFLNPYTDEVEYIVCTNSSGKTMHGAPLDAAAAHTPEQVQQQQQQEQHVYVQAAPGVDYARRELTPVGSATNDGMYQTHMLAMQAPTPQQQQQQQQRPGSAQTTPVGYTYDTTHSPYSAGGPSPLAKIPKSGTSPTPVAPNSWAALRPQQQQQQQQPVTEGYQYQQTSPARSPSGPTYTQLSAGNGNRQQAQPGAYQAGPPPPPNAPGMWDWQQAGGHPHPPHPTAHPHHPHAHPGGPAGAGQPQGQEFSDMLQMLDHTPTTFEDLNINMFSTPFE |
Proteomic databases
Expression
Tissue specificity
At stage 11, expression is detected in tracheal pits. At later stages, strong expression is also detected in the CNS.
Developmental stage
Expressed both maternally and zygotically in pupae at a low level.
Gene expression databases
Interaction
Subunit
Efficient DNA binding requires dimerization with another bHLH protein. Heterodimer with ahr, trh or sim.
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O15945 | sim P05709 | 3 | EBI-172695, EBI-88929 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, compositional bias, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 13-66 | bHLH | ||||
Sequence: ASRENHCEIERRRRNKMTAYITELSDMVPTCSALARKPDKLTILRMAVAHMKAL | ||||||
Domain | 85-156 | PAS 1 | ||||
Sequence: DQELKHLILEAADGFLFVVSCDSGRVIYVSDSVTPVLNYTQSDWYGTSLYEHIHPDDREKIREQLSTQESQN | ||||||
Domain | 271-341 | PAS 2 | ||||
Sequence: TAANDMSGSNNQSEFITRHAMDGKFTFVDQRVLNILGYTPTELLGKICYDFFHPEDQSHMKESFDQVLKQK | ||||||
Domain | 346-389 | PAC | ||||
Sequence: SLLYRARAKNSEYVWLRTQAYAFLNPYTDEVEYIVCTNSSGKTM | ||||||
Compositional bias | 450-485 | Polar residues | ||||
Sequence: QAPTPQQQQQQQQRPGSAQTTPVGYTYDTTHSPYSA | ||||||
Region | 450-612 | Disordered | ||||
Sequence: QAPTPQQQQQQQQRPGSAQTTPVGYTYDTTHSPYSAGGPSPLAKIPKSGTSPTPVAPNSWAALRPQQQQQQQQPVTEGYQYQQTSPARSPSGPTYTQLSAGNGNRQQAQPGAYQAGPPPPPNAPGMWDWQQAGGHPHPPHPTAHPHHPHAHPGGPAGAGQPQG | ||||||
Compositional bias | 500-560 | Polar residues | ||||
Sequence: SPTPVAPNSWAALRPQQQQQQQQPVTEGYQYQQTSPARSPSGPTYTQLSAGNGNRQQAQPG |
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length642
- Mass (Da)71,475
- Last updated2012-03-21 v3
- Checksum0D2EB5D7651C98CC
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A0B4KFJ2 | A0A0B4KFJ2_DROME | tgo | 642 |
Sequence caution
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 110 | in Ref. 1; BAA22868 | ||||
Sequence: V → M | ||||||
Sequence conflict | 410 | in Ref. 2; AAB69695, 3; AAB88882 and 4; AAD38396 | ||||
Sequence: Q → QQQ | ||||||
Compositional bias | 450-485 | Polar residues | ||||
Sequence: QAPTPQQQQQQQQRPGSAQTTPVGYTYDTTHSPYSA | ||||||
Sequence conflict | 465 | in Ref. 1; BAA22868 | ||||
Sequence: G → R | ||||||
Sequence conflict | 488 | in Ref. 2; AAB69695 | ||||
Sequence: P → T | ||||||
Compositional bias | 500-560 | Polar residues | ||||
Sequence: SPTPVAPNSWAALRPQQQQQQQQPVTEGYQYQQTSPARSPSGPTYTQLSAGNGNRQQAQPG |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB002556 EMBL· GenBank· DDBJ | BAA22868.1 EMBL· GenBank· DDBJ | mRNA | ||
AF016053 EMBL· GenBank· DDBJ | AAB69695.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
AF020426 EMBL· GenBank· DDBJ | AAB88882.1 EMBL· GenBank· DDBJ | mRNA | ||
AF154417 EMBL· GenBank· DDBJ | AAD38396.1 EMBL· GenBank· DDBJ | mRNA | ||
AE014297 EMBL· GenBank· DDBJ | AAF54329.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY069581 EMBL· GenBank· DDBJ | AAL39726.1 EMBL· GenBank· DDBJ | mRNA | ||
M14550 EMBL· GenBank· DDBJ | AAA28838.1 EMBL· GenBank· DDBJ | Genomic DNA | Frameshift |