O15467 · CCL16_HUMAN
- ProteinC-C motif chemokine 16
- GeneCCL16
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids120 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Shows chemotactic activity for lymphocytes and monocytes but not neutrophils. Also shows potent myelosuppressive activity, suppresses proliferation of myeloid progenitor cells. Recombinant SCYA16 shows chemotactic activity for monocytes and THP-1 monocytes, but not for resting lymphocytes and neutrophils. Induces a calcium flux in THP-1 cells that were desensitized by prior expression to RANTES.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | extracellular space | |
Molecular Function | CCR chemokine receptor binding | |
Molecular Function | chemoattractant activity | |
Molecular Function | chemokine activity | |
Biological Process | antimicrobial humoral immune response mediated by antimicrobial peptide | |
Biological Process | cell communication | |
Biological Process | cell-cell signaling | |
Biological Process | chemokine-mediated signaling pathway | |
Biological Process | chemotaxis | |
Biological Process | eosinophil chemotaxis | |
Biological Process | inflammatory response | |
Biological Process | positive regulation of cell migration |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameC-C motif chemokine 16
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO15467
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 237 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-23 | |||||
Sequence: MKVSEAALSLLVLILIITSASRS | ||||||
Chain | PRO_0000005209 | 24-120 | C-C motif chemokine 16 | |||
Sequence: QPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ | ||||||
Disulfide bond | 37↔60 | |||||
Sequence: CCLKYYEKVLPRRLVVGYRKALNC | ||||||
Disulfide bond | 38↔76 | |||||
Sequence: CLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVC |
Keywords
- PTM
Proteomic databases
Expression
Tissue specificity
Mainly expressed in liver, also found in spleen and thymus. Highly expressed in LPS- and IFN-gamma-activated monocytes, weakly in some lymphocytes, including natural killer cells, gamma-delta T-cells, and some T-cell clones.
Induction
By IL10/interleukin-10.
Gene expression databases
Organism-specific databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O15467 | CCL5 P13501 | 2 | EBI-12204739, EBI-2848366 | |
BINARY | O15467 | UBQLN2 Q9UHD9 | 3 | EBI-12204739, EBI-947187 |
Protein-protein interaction databases
Miscellaneous
Structure
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length120
- Mass (Da)13,600
- Last updated1998-01-01 v1
- Checksum373D73016134D894
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A087WUE5 | A0A087WUE5_HUMAN | CCL16 | 95 | ||
A0A087WUU4 | A0A087WUU4_HUMAN | CCL16 | 53 |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U91746 EMBL· GenBank· DDBJ | AAC05587.1 EMBL· GenBank· DDBJ | mRNA | ||
AB007454 EMBL· GenBank· DDBJ | BAA24057.1 EMBL· GenBank· DDBJ | mRNA | ||
AF088219 EMBL· GenBank· DDBJ | AAC63330.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF055467 EMBL· GenBank· DDBJ | AAC28844.1 EMBL· GenBank· DDBJ | mRNA | ||
AB018249 EMBL· GenBank· DDBJ | BAA35138.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF039954 EMBL· GenBank· DDBJ | AAC97450.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AF039955 EMBL· GenBank· DDBJ | AAC97451.1 EMBL· GenBank· DDBJ | mRNA | ||
BC099662 EMBL· GenBank· DDBJ | AAH99662.1 EMBL· GenBank· DDBJ | mRNA |