O15318 · RPC7_HUMAN
- ProteinDNA-directed RNA polymerase III subunit RPC7
- GenePOLR3G
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids223 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates (PubMed:20413673, PubMed:33558764, PubMed:34675218, PubMed:35637192).
Specific peripheric component of RNA polymerase III (Pol III) which synthesizes small non-coding RNAs including 5S rRNA, snRNAs, tRNAs and miRNAs from at least 500 distinct genomic loci (PubMed:20154270, PubMed:20413673, PubMed:35637192).
Acts as a long tether that bridges POLR3C/RPC3-POLR3F/RPC6-POLR3G/RPC7 heterotrimer and the mobile stalk of Pol III, coordinating the dynamics of Pol III stalk and clamp modules during the transition from apo to elongation state. Pol III exists as two alternative complexes defined by the mutually exclusive incorporation of subunit POLR3G/RPC7alpha or POLR3GL/RPC7beta. POLR3G/RPC7alpha modulates Pol III transcriptome by specifically enhancing the transcription of snaR-A non-coding RNAs. At resting state, occupies the active site of apo Pol III and keeps Pol III in an autoinhibitory mode, preventing non-specific transcription (PubMed:33558764, PubMed:33558766, PubMed:35637192).
Pol III plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as a nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs), induce type I interferon and NF-kappa-B through the RIG-I pathway (PubMed:19609254, PubMed:19631370).
Specific peripheric component of RNA polymerase III (Pol III) which synthesizes small non-coding RNAs including 5S rRNA, snRNAs, tRNAs and miRNAs from at least 500 distinct genomic loci (PubMed:20154270, PubMed:20413673, PubMed:35637192).
Acts as a long tether that bridges POLR3C/RPC3-POLR3F/RPC6-POLR3G/RPC7 heterotrimer and the mobile stalk of Pol III, coordinating the dynamics of Pol III stalk and clamp modules during the transition from apo to elongation state. Pol III exists as two alternative complexes defined by the mutually exclusive incorporation of subunit POLR3G/RPC7alpha or POLR3GL/RPC7beta. POLR3G/RPC7alpha modulates Pol III transcriptome by specifically enhancing the transcription of snaR-A non-coding RNAs. At resting state, occupies the active site of apo Pol III and keeps Pol III in an autoinhibitory mode, preventing non-specific transcription (PubMed:33558764, PubMed:33558766, PubMed:35637192).
Pol III plays a key role in sensing and limiting infection by intracellular bacteria and DNA viruses. Acts as a nuclear and cytosolic DNA sensor involved in innate immune response. Can sense non-self dsDNA that serves as template for transcription into dsRNA. The non-self RNA polymerase III transcripts, such as Epstein-Barr virus-encoded RNAs (EBERs), induce type I interferon and NF-kappa-B through the RIG-I pathway (PubMed:19609254, PubMed:19631370).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytosol | |
Cellular Component | nuclear body | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Cellular Component | RNA polymerase III complex | |
Molecular Function | chromatin binding | |
Molecular Function | DNA-directed 5'-3' RNA polymerase activity | |
Biological Process | cell population proliferation | |
Biological Process | defense response to virus | |
Biological Process | innate immune response | |
Biological Process | positive regulation of innate immune response | |
Biological Process | positive regulation of interferon-beta production | |
Biological Process | regulation of transcription by RNA polymerase III | |
Biological Process | transcription by RNA polymerase III |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameDNA-directed RNA polymerase III subunit RPC7
- Short namesRNA polymerase III subunit C7
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO15318
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 248 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000073978 | 1-223 | UniProt | DNA-directed RNA polymerase III subunit RPC7 | |||
Sequence: MAGNKGRGRAAYTFNIEAVGFSKGEKLPDVVLKPPPLFPDTDYKPVPLKTGEGEEYMLALKQELRETMKRMPYFIETPEERQDIERYSKRYMKVYKEEWIPDWRRLPREMMPRNKCKKAGPKPKKAKDAGKGTPLTNTEDVLKKMEELEKRGDGEKSDEENEEKEGSKEKSKEGDDDDDDDAAEQEEYDEEEQEEENDYINSYFEDGDDFGADSDDNMDEATY | |||||||
Modified residue | 133 | UniProt | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue (large scale data) | 133 | PRIDE | Phosphothreonine | ||||
Sequence: T | |||||||
Modified residue | 157 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 157 | PRIDE | Phosphoserine | ||||
Sequence: S |
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Barely detectable in differentiated tissues. Expressed in embryonic stem cells and in other dividing cells, such as some tumor cell lines.
Induction
Induced by NANOG and POU5F1/OCT4 (PubMed:21898682).
Negatively regulated by the interaction of microRNA MIR1305 with 3 miRNA responsive elements (miREs) in its 3'-UTR (PubMed:27339422).
Transcriptionally regulated by MYC. down-regulated upon cell differentiation
Negatively regulated by the interaction of microRNA MIR1305 with 3 miRNA responsive elements (miREs) in its 3'-UTR (PubMed:27339422).
Transcriptionally regulated by MYC. down-regulated upon cell differentiation
Developmental stage
Down-regulated in embryonic stem cells upon differentiation into embroid bodies (at protein level) (PubMed:20154270, PubMed:21898682, PubMed:28494942).
An analogous down-regulation is observed during differentiation of induced pluripotent stem cells (PubMed:21898682).
An analogous down-regulation is observed during differentiation of induced pluripotent stem cells (PubMed:21898682).
Gene expression databases
Organism-specific databases
Interaction
Subunit
Component of the RNA polymerase III complex consisting of 17 subunits: a ten-subunit horseshoe-shaped catalytic core composed of POLR3A/RPC1, POLR3B/RPC2, POLR1C/RPAC1, POLR1D/RPAC2, POLR3K/RPC10, POLR2E/RPABC1, POLR2F/RPABC2, POLR2H/RPABC3, POLR2K/RPABC4 and POLR2L/RPABC5; a mobile stalk composed of two subunits POLR3H/RPC8 and CRCP/RPC9, protruding from the core and functioning primarily in transcription initiation; and additional subunits homologous to general transcription factors of the RNA polymerase II machinery, POLR3C/RPC3-POLR3F/RPC6-POLR3G/RPC7 heterotrimer required for transcription initiation and POLR3D/RPC4-POLR3E/RPC5 heterodimer involved in both transcription initiation and termination (PubMed:12391170, PubMed:33335104, PubMed:33558764, PubMed:33558766, PubMed:33674783, PubMed:34675218, PubMed:35637192).
Directly interacts with POLR3C/RPC62 (PubMed:21358628, PubMed:24107381, PubMed:26394183).
Also found in a trimeric complex with POLR3C/RPC3 and POLR3GL (PubMed:24107381).
Directly interacts with POLR3C/RPC62 (PubMed:21358628, PubMed:24107381, PubMed:26394183).
Also found in a trimeric complex with POLR3C/RPC3 and POLR3GL (PubMed:24107381).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O15318 | POLR3C Q9BUI4 | 9 | EBI-12362221, EBI-5452779 | |
BINARY | O15318 | POLR3F Q9H1D9 | 5 | EBI-12362221, EBI-710067 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 110-223 | Disordered | ||||
Sequence: MMPRNKCKKAGPKPKKAKDAGKGTPLTNTEDVLKKMEELEKRGDGEKSDEENEEKEGSKEKSKEGDDDDDDDAAEQEEYDEEEQEEENDYINSYFEDGDDFGADSDDNMDEATY | ||||||
Compositional bias | 140-173 | Basic and acidic residues | ||||
Sequence: DVLKKMEELEKRGDGEKSDEENEEKEGSKEKSKE | ||||||
Compositional bias | 174-223 | Acidic residues | ||||
Sequence: GDDDDDDDAAEQEEYDEEEQEEENDYINSYFEDGDDFGADSDDNMDEATY |
Sequence similarities
Belongs to the eukaryotic RPC7 RNA polymerase subunit family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length223
- Mass (Da)25,914
- Last updated2008-12-16 v2
- Checksum95E506D527962DD9
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A7I2R591 | A0A7I2R591_HUMAN | POLR3G | 151 | ||
D6RJH6 | D6RJH6_HUMAN | POLR3G | 100 | ||
D6RIT0 | D6RIT0_HUMAN | POLR3G | 92 | ||
D6REQ0 | D6REQ0_HUMAN | POLR3G | 39 | ||
D6R9U7 | D6R9U7_HUMAN | POLR3G | 220 |
Sequence caution
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 96 | in Ref. 1; AAB63676 | ||||
Sequence: K → Q | ||||||
Compositional bias | 140-173 | Basic and acidic residues | ||||
Sequence: DVLKKMEELEKRGDGEKSDEENEEKEGSKEKSKE | ||||||
Sequence conflict | 146 | in Ref. 1; AAB63676 | ||||
Sequence: E → V | ||||||
Compositional bias | 174-223 | Acidic residues | ||||
Sequence: GDDDDDDDAAEQEEYDEEEQEEENDYINSYFEDGDDFGADSDDNMDEATY |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U93868 EMBL· GenBank· DDBJ | AAB63676.1 EMBL· GenBank· DDBJ | mRNA | Frameshift | |
AK295434 EMBL· GenBank· DDBJ | BAG58376.1 EMBL· GenBank· DDBJ | mRNA | ||
AC027323 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
AC093510 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471084 EMBL· GenBank· DDBJ | EAW95980.1 EMBL· GenBank· DDBJ | Genomic DNA |