O15130 · NPFF_HUMAN
- ProteinPro-FMRFamide-related neuropeptide FF
- GeneNPFF
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids113 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Morphine modulating peptides. Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas. Neuropeptide FF potentiates and sensitizes ASIC1 and ASIC3 channels.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | axon terminus | |
Cellular Component | dendrite | |
Cellular Component | extracellular region | |
Cellular Component | extracellular space | |
Cellular Component | perikaryon | |
Cellular Component | postsynapse | |
Molecular Function | G protein-coupled receptor binding | |
Molecular Function | neuropeptide hormone activity | |
Molecular Function | signaling receptor binding | |
Biological Process | chemical synaptic transmission | |
Biological Process | excitatory postsynaptic potential | |
Biological Process | neuropeptide signaling pathway |
Keywords
- Molecular function
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended namePro-FMRFamide-related neuropeptide FF
- Alternative names
- Cleaved into 3 chains
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO15130
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_049183 | 88 | in dbSNP:rs35822762 | |||
Sequence: W → R |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 137 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, propeptide, peptide, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-20 | |||||
Sequence: MDSRQAAALLVLLLLIDGGC | ||||||
Propeptide | PRO_0000009898 | 21-65 | ||||
Sequence: AEGPGGQQEDQLSAEEDSEPLPPQDAQTSGSLLHYLLQAMERPGR | ||||||
Peptide | PRO_0000009899 | 66-76 | Neuropeptide SF | |||
Sequence: SQAFLFQPQRF | ||||||
Peptide | PRO_0000009900 | 69-76 | Neuropeptide FF | |||
Sequence: FLFQPQRF | ||||||
Modified residue | 76 | Phenylalanine amide | ||||
Sequence: F | ||||||
Propeptide | PRO_0000009901 | 79-92 | ||||
Sequence: NTQGSWRNEWLSPR | ||||||
Peptide | PRO_0000009902 | 93-110 | Neuropeptide AF | |||
Sequence: AGEGLNSQFWSLAAPQRF | ||||||
Modified residue | 110 | Phenylalanine amide | ||||
Sequence: F |
Keywords
- PTM
Proteomic databases
Interaction
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O15130-2 | CCT5 P48643 | 3 | EBI-25840002, EBI-355710 | |
BINARY | O15130-2 | CTSD P07339 | 3 | EBI-25840002, EBI-2115097 | |
BINARY | O15130-2 | HTT P42858 | 18 | EBI-25840002, EBI-466029 | |
BINARY | O15130-2 | LAMP2 P13473-2 | 3 | EBI-25840002, EBI-21591415 | |
BINARY | O15130-2 | SH3GLB1 Q9Y371 | 3 | EBI-25840002, EBI-2623095 | |
BINARY | O15130-2 | WFS1 O76024 | 3 | EBI-25840002, EBI-720609 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 22-48 | Disordered | ||||
Sequence: EGPGGQQEDQLSAEEDSEPLPPQDAQT |
Sequence similarities
Belongs to the FARP (FMRFamide related peptide) family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
This entry describes 2 isoforms produced by Alternative splicing.
O15130-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- Length113
- Mass (Da)12,440
- Last updated1998-01-01 v1
- Checksum1E9D4ED2A69238E3
O15130-2
- Name2
- Differences from canonical
- 1-34: MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSA → MVPQPPTTCPWKPVPSPCDLRVQGICPSSFPDTPLAQ
Features
Showing features for alternative sequence.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_056475 | 1-34 | in isoform 2 | |||
Sequence: MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSA → MVPQPPTTCPWKPVPSPCDLRVQGICPSSFPDTPLAQ |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF005271 EMBL· GenBank· DDBJ | AAB64288.1 EMBL· GenBank· DDBJ | mRNA | ||
AC023509 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471054 EMBL· GenBank· DDBJ | EAW96721.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC104234 EMBL· GenBank· DDBJ | AAI04235.1 EMBL· GenBank· DDBJ | mRNA | ||
BC104235 EMBL· GenBank· DDBJ | AAI04236.1 EMBL· GenBank· DDBJ | mRNA |