O14978 · ZN263_HUMAN
- ProteinZinc finger protein 263
- GeneZNF263
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids683 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription factor that binds to the consensus sequence 5'-TCCTCCC-3' and acts as a transcriptional repressor (PubMed:32051553).
Binds to the promoter region of SIX3 and recruits other proteins involved in chromatin modification and transcriptional corepression, resulting in methylation of the promoter and transcriptional repression (PubMed:32051553).
Acts as a transcriptional repressor of HS3ST1 and HS3ST3A1 via binding to gene promoter regions (PubMed:32277030).
Binds to the promoter region of SIX3 and recruits other proteins involved in chromatin modification and transcriptional corepression, resulting in methylation of the promoter and transcriptional repression (PubMed:32051553).
Acts as a transcriptional repressor of HS3ST1 and HS3ST3A1 via binding to gene promoter regions (PubMed:32277030).
Miscellaneous
May be involved in the EGFR-mediated promotion of invasion and anchorage-independent growth in glioblastomas via silencing of SIX3 (PubMed:32051553).
May act as a prognostic indicator in glioblastoma patients, with increased expression correlating with poor prognosis (PubMed:32051553).
May act as a prognostic indicator in glioblastoma patients, with increased expression correlating with poor prognosis (PubMed:32051553).
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | DNA-binding transcription repressor activity, RNA polymerase II-specific | |
Molecular Function | metal ion binding | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Molecular Function | sequence-specific DNA binding | |
Molecular Function | sequence-specific double-stranded DNA binding | |
Molecular Function | transcription cis-regulatory region binding | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of DNA-templated transcription | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameZinc finger protein 263
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO14978
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_052801 | 310 | in dbSNP:rs220379 | |||
Sequence: C → S | ||||||
Natural variant | VAR_052802 | 534 | in dbSNP:rs34236132 | |||
Sequence: V → I | ||||||
Natural variant | VAR_061943 | 646 | in dbSNP:rs57710602 | |||
Sequence: R → Q | ||||||
Natural variant | VAR_084704 | 646 | found in a patient with hypothalamic hamartoma; uncertain significance; dbSNP:rs747714553 | |||
Sequence: R → W |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 814 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data), cross-link, modified residue.
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000047491 | 1-683 | UniProt | Zinc finger protein 263 | |||
Sequence: MASGPGSQEREGLLIVKLEEDCAWSQELPPPDPGPSPEASHLRFRRFRFQEAAGPREALSRLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQRELGRLRQQVTNHGRGTEVLLEEPLPLETARESPSFKLEPMETERSPGPRLQELLGPSPQRDPQAVKERALSAPWLSLFPPEGNMEDKEMTGPQLPESLEDVAMYISQEEWGHQDPSKRALSRDTVQESYENVDSLESHIPSQEVPGTQVGQGGKLWDPSVQSCKEGLSPRGPAPGEEKFENLEGVPSVCSENIHPQVLLPDQARGEVPWSPELGRPHDRSQGDWAPPPEGGMEQALAGASSGRELGRPKELQPKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVDCTEIFGGNPRFLSLHRAHLGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNICGKCFSCNSNLHRHQRTHTGEKPYKCPECGEIFAHSSNLLRHQRIHTGERPYKCPECGKSFSRSSHLVIHERTHERERLYPFSECGEAVSDSTPFLTNHGAHKAEKKLFECLTCGKSFRQGMHLTRHQRTHTGEKPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPYKCSECGESFSRSSRLMSHQRTHTG | |||||||
Modified residue (large scale data) | 7 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 17 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 153 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 157 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue | 166 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 166 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue | 178 | UniProt | Phosphoserine | ||||
Sequence: S | |||||||
Modified residue (large scale data) | 178 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 285 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Modified residue (large scale data) | 289 | PRIDE | Phosphoserine | ||||
Sequence: S | |||||||
Cross-link | 299 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 376 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 573 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | |||||||
Cross-link | 582 | UniProt | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K |
Post-translational modification
Ubiquitinated, leading to proteasomal degradation.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney, pancreas, spleen, thymus, prostate, testis, ovary, small intestine, colon and leukocyte.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Interacts with a number of proteins involved in chromatin modification and transcriptional corepression including DNMT1, DNMT3A, HDAC2, PHF8, TRIM28/KAP1, SETDB1, EZH2, UHRF1, CBX3/HP1-gamma, and CBX5/HP1-alpha; recruits these proteins to the SIX3 promoter region, leading to SIX3 transcriptional repression (PubMed:32051553).
Interacts with MAPK3/ERK1 and MAPK1/ERK2 (PubMed:32051553).
Interacts with MAPK3/ERK1 and MAPK1/ERK2 (PubMed:32051553).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O14978 | CLK2 P49760 | 3 | EBI-744493, EBI-750020 | |
BINARY | O14978 | CLK3 P49761 | 3 | EBI-744493, EBI-745579 | |
BINARY | O14978 | GPATCH2L Q9NWQ4 | 3 | EBI-744493, EBI-5666657 | |
BINARY | O14978 | GPATCH2L Q9NWQ4-1 | 3 | EBI-744493, EBI-11959863 | |
BINARY | O14978 | JAKMIP2 Q96AA8 | 3 | EBI-744493, EBI-752007 | |
BINARY | O14978 | LNX1 Q8TBB1 | 3 | EBI-744493, EBI-739832 | |
BINARY | O14978 | PPL O60437 | 3 | EBI-744493, EBI-368321 | |
BINARY | O14978 | SCAND1 P57086 | 7 | EBI-744493, EBI-745846 | |
BINARY | O14978 | TCAF1 Q9Y4C2 | 3 | EBI-744493, EBI-750484 | |
BINARY | O14978 | TRIM41 Q8WV44 | 7 | EBI-744493, EBI-725997 | |
BINARY | O14978 | ZNF165 P49910 | 3 | EBI-744493, EBI-741694 | |
BINARY | O14978 | ZSCAN22 P10073 | 3 | EBI-744493, EBI-10178224 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias, zinc finger.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 41-123 | SCAN box | ||||
Sequence: HLRFRRFRFQEAAGPREALSRLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQREL | ||||||
Region | 147-185 | Disordered | ||||
Sequence: LETARESPSFKLEPMETERSPGPRLQELLGPSPQRDPQA | ||||||
Domain | 217-289 | KRAB | ||||
Sequence: ESLEDVAMYISQEEWGHQDPSKRALSRDTVQESYENVDSLESHIPSQEVPGTQVGQGGKLWDPSVQSCKEGLS | ||||||
Region | 230-301 | Disordered | ||||
Sequence: EWGHQDPSKRALSRDTVQESYENVDSLESHIPSQEVPGTQVGQGGKLWDPSVQSCKEGLSPRGPAPGEEKFE | ||||||
Compositional bias | 246-269 | Polar residues | ||||
Sequence: VQESYENVDSLESHIPSQEVPGTQ | ||||||
Region | 322-368 | Disordered | ||||
Sequence: DQARGEVPWSPELGRPHDRSQGDWAPPPEGGMEQALAGASSGRELGR | ||||||
Zinc finger | 378-400 | C2H2-type 1 | ||||
Sequence: HLCPLCGKNFSNNSNLIRHQRIH | ||||||
Zinc finger | 434-456 | C2H2-type 2 | ||||
Sequence: HKCLECGKCFSQNTHLTRHQRTH | ||||||
Zinc finger | 462-484 | C2H2-type 3 | ||||
Sequence: YQCNICGKCFSCNSNLHRHQRTH | ||||||
Zinc finger | 490-512 | C2H2-type 4 | ||||
Sequence: YKCPECGEIFAHSSNLLRHQRIH | ||||||
Zinc finger | 518-540 | C2H2-type 5 | ||||
Sequence: YKCPECGKSFSRSSHLVIHERTH | ||||||
Zinc finger | 575-597 | C2H2-type 6 | ||||
Sequence: FECLTCGKSFRQGMHLTRHQRTH | ||||||
Zinc finger | 603-625 | C2H2-type 7 | ||||
Sequence: YKCTLCGENFSHRSNLIRHQRIH | ||||||
Zinc finger | 631-653 | C2H2-type 8 | ||||
Sequence: YTCHECGDSFSHSSNRIRHLRTH | ||||||
Zinc finger | 659-681 | C2H2-type 9 | ||||
Sequence: YKCSECGESFSRSSRLMSHQRTH |
Sequence similarities
Belongs to the krueppel C2H2-type zinc-finger protein family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length683
- Mass (Da)77,299
- Last updated2002-10-25 v2
- Checksum1E02C862FCE69265
Computationally mapped potential isoform sequences
There are 5 potential isoforms mapped to this entry
Features
Showing features for sequence conflict, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 118 | in Ref. 1; BAA21853 | ||||
Sequence: D → G | ||||||
Compositional bias | 246-269 | Polar residues | ||||
Sequence: VQESYENVDSLESHIPSQEVPGTQ |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
D88827 EMBL· GenBank· DDBJ | BAA21853.1 EMBL· GenBank· DDBJ | mRNA | ||
AK312421 EMBL· GenBank· DDBJ | BAG35331.1 EMBL· GenBank· DDBJ | mRNA | ||
AC004232 EMBL· GenBank· DDBJ | AAC24490.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471112 EMBL· GenBank· DDBJ | EAW85379.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC008805 EMBL· GenBank· DDBJ | AAH08805.1 EMBL· GenBank· DDBJ | mRNA |