O14948 · TFEC_HUMAN
- ProteinTranscription factor EC
- GeneTFEC
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids347 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcriptional regulator that acts as a repressor or an activator. Acts as a transcriptional repressor on minimal promoter containing element F (that includes an E-box sequence). Binds to element F in an E-box sequence-specific manner. Acts as a transcriptional transactivator on the proximal promoter region of the tartrate-resistant acid phosphatase (TRAP) E-box containing promoter (By similarity).
Collaborates with MITF in target gene activation (By similarity).
Acts as a transcriptional repressor on minimal promoter containing mu E3 enhancer sequence (By similarity).
Binds to mu E3 DNA sequence of the immunoglobulin heavy-chain gene enhancer (By similarity).
Binds DNA in a homo- or heterodimeric form
Collaborates with MITF in target gene activation (By similarity).
Acts as a transcriptional repressor on minimal promoter containing mu E3 enhancer sequence (By similarity).
Binds to mu E3 DNA sequence of the immunoglobulin heavy-chain gene enhancer (By similarity).
Binds DNA in a homo- or heterodimeric form
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | chromatin | |
Cellular Component | cytosol | |
Cellular Component | nucleoplasm | |
Cellular Component | nucleus | |
Molecular Function | DNA-binding transcription activator activity, RNA polymerase II-specific | |
Molecular Function | DNA-binding transcription factor activity, RNA polymerase II-specific | |
Molecular Function | DNA-binding transcription repressor activity, RNA polymerase II-specific | |
Molecular Function | protein dimerization activity | |
Molecular Function | RNA polymerase II cis-regulatory region sequence-specific DNA binding | |
Molecular Function | sequence-specific double-stranded DNA binding | |
Biological Process | cellular response to heat | |
Biological Process | negative regulation of transcription by RNA polymerase II | |
Biological Process | positive regulation of transcription by RNA polymerase II | |
Biological Process | regulation of transcription by RNA polymerase II |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameTranscription factor EC
- Short namesTFE-C
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO14948
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_037661 | 6 | in dbSNP:rs35695387 | |||
Sequence: Q → H | ||||||
Natural variant | VAR_037662 | 100 | in dbSNP:rs35170691 | |||
Sequence: G → S | ||||||
Natural variant | VAR_037663 | 146 | in a colorectal cancer sample; somatic mutation | |||
Sequence: L → V |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 425 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain, modified residue (large scale data).
Type | ID | Position(s) | Source | Description | |||
---|---|---|---|---|---|---|---|
Chain | PRO_0000313564 | 1-347 | UniProt | Transcription factor EC | |||
Sequence: MTLDHQIINPTLKWSQPAVPSGGPLVQHAHTTLDSDAGLTENPLTKLLAIGKEDDNAQWHMEDVIEDIIGMESSFKEEGADSPLLMQRTLSGSILDVYSGEQGISPINMGLTSASCPSSLPMKREITETDTRALAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGTILKASVEYIKWLQKEQQRARELEHRQKKLEQANRRLLLRIQELEIQARTHGLPTLASLGTVDLGAHVTKQQSHPEQNSVDYCQQLTVSQGPSPELCDQAIAFSDPLSYFTDLSFSAALKEEQRLDGMLLDDTISPFGTDPLLSATSPAVSKESSRRSSFSSDDGDEL | |||||||
Modified residue (large scale data) | 330 | PRIDE | Phosphoserine | ||||
Sequence: S |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed moderately in spleen, kidney, bone marrow, small intestine and leukocytes. Expressed weakly in testis, trachea and colon.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Homodimer. Forms heterodimers with TFE3. Forms heterodimers with MITF (By similarity).
Interacts with MITF (By similarity).
Interacts with MITF (By similarity).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O14948 | DEFB127 Q9H1M4 | 3 | EBI-3916574, EBI-10305240 | |
BINARY | O14948 | NAPB Q9H115 | 3 | EBI-3916574, EBI-3921185 | |
BINARY | O14948-3 | LPAR3 Q9UBY5 | 3 | EBI-12246506, EBI-12033434 | |
BINARY | O14948-3 | SMCO4 Q9NRQ5 | 3 | EBI-12246506, EBI-8640191 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region, domain, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-119 | Necessary for transcriptional transactivation | ||||
Sequence: MTLDHQIINPTLKWSQPAVPSGGPLVQHAHTTLDSDAGLTENPLTKLLAIGKEDDNAQWHMEDVIEDIIGMESSFKEEGADSPLLMQRTLSGSILDVYSGEQGISPINMGLTSASCPSS | ||||||
Domain | 139-192 | bHLH | ||||
Sequence: QKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGTILKASVEYIKWL | ||||||
Region | 271-347 | Necessary for transcriptional transactivation | ||||
Sequence: PSPELCDQAIAFSDPLSYFTDLSFSAALKEEQRLDGMLLDDTISPFGTDPLLSATSPAVSKESSRRSSFSSDDGDEL | ||||||
Compositional bias | 319-335 | Polar residues | ||||
Sequence: DPLLSATSPAVSKESSR | ||||||
Region | 319-347 | Disordered | ||||
Sequence: DPLLSATSPAVSKESSRRSSFSSDDGDEL |
Sequence similarities
Belongs to the MiT/TFE family.
Phylogenomic databases
Family and domain databases
Sequence & Isoforms
- Sequence statusComplete
This entry describes 4 isoforms produced by Alternative splicing.
O14948-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Name1
- SynonymsTFEC-l, TFECL
- Length347
- Mass (Da)38,788
- Last updated1998-01-01 v1
- ChecksumA29B4C4A1C88A985
O14948-2
- Name2
- SynonymsTFEC-s
- Differences from canonical
- 61-89: Missing
O14948-3
- Name3
O14948-4
- Name4
- SynonymsTFEC-C
Computationally mapped potential isoform sequences
There is 1 potential isoform mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
B7Z757 | B7Z757_HUMAN | TFEC | 316 |
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_030022 | 1-67 | in isoform 4 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_030023 | 61-89 | in isoform 2 and isoform 3 | |||
Sequence: Missing | ||||||
Alternative sequence | VSP_030024 | 68-89 | in isoform 4 | |||
Sequence: IIGMESSFKEEGADSPLLMQRT → MMKEKEKTIAIVKVIDTSKLKL | ||||||
Alternative sequence | VSP_030025 | 222-226 | in isoform 3 | |||
Sequence: ELEIQ → VFIRM | ||||||
Alternative sequence | VSP_030026 | 227-347 | in isoform 3 | |||
Sequence: Missing | ||||||
Compositional bias | 319-335 | Polar residues | ||||
Sequence: DPLLSATSPAVSKESSR |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
D43945 EMBL· GenBank· DDBJ | BAA21908.1 EMBL· GenBank· DDBJ | mRNA | ||
AK313546 EMBL· GenBank· DDBJ | BAG36322.1 EMBL· GenBank· DDBJ | mRNA | ||
CR933605 EMBL· GenBank· DDBJ | CAI45926.1 EMBL· GenBank· DDBJ | mRNA | ||
CH236947 EMBL· GenBank· DDBJ | EAL24366.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471070 EMBL· GenBank· DDBJ | EAW83491.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CH471070 EMBL· GenBank· DDBJ | EAW83492.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC029891 EMBL· GenBank· DDBJ | AAH29891.1 EMBL· GenBank· DDBJ | mRNA | ||
AJ608795 EMBL· GenBank· DDBJ | CAE77680.1 EMBL· GenBank· DDBJ | mRNA |