O14910 · LIN7A_HUMAN
- ProteinProtein lin-7 homolog A
- GeneLIN7A
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids233 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Plays a role in establishing and maintaining the asymmetric distribution of channels and receptors at the plasma membrane of polarized cells. Forms membrane-associated multiprotein complexes that may regulate delivery and recycling of proteins to the correct membrane domains. The tripartite complex composed of LIN7 (LIN7A, LIN7B or LIN7C), CASK and APBA1 associates with the motor protein KIF17 to transport vesicles containing N-methyl-D-aspartate (NMDA) receptor subunit NR2B along microtubules (By similarity).
This complex may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells
This complex may have the potential to couple synaptic vesicle exocytosis to cell adhesion in brain. Ensures the proper localization of GRIN2B (subunit 2B of the NMDA receptor) to neuronal postsynaptic density and may function in localizing synaptic vesicles at synapses where it is recruited by beta-catenin and cadherin. Required to localize Kir2 channels, GABA transporter (SLC6A12) and EGFR/ERBB1, ERBB2, ERBB3 and ERBB4 to the basolateral membrane of epithelial cells
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | basolateral plasma membrane | |
Cellular Component | bicellular tight junction | |
Cellular Component | cell-cell junction | |
Cellular Component | extracellular exosome | |
Cellular Component | MPP7-DLG1-LIN7 complex | |
Cellular Component | plasma membrane | |
Cellular Component | postsynaptic density membrane | |
Cellular Component | presynapse | |
Cellular Component | synapse | |
Molecular Function | L27 domain binding | |
Biological Process | exocytosis | |
Biological Process | inner ear development | |
Biological Process | maintenance of epithelial cell apical/basal polarity | |
Biological Process | neurotransmitter secretion | |
Biological Process | protein localization to basolateral plasma membrane | |
Biological Process | protein transport | |
Biological Process | protein-containing complex assembly | |
Biological Process | synaptic vesicle transport |
Keywords
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein lin-7 homolog A
- Short namesLin-7A; hLin-7
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO14910
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Peripheral membrane protein
Basolateral cell membrane ; Peripheral membrane protein
Postsynaptic density membrane ; Peripheral membrane protein
Note: Mainly basolateral in renal epithelial cells.
Keywords
- Cellular component
Disease & Variants
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 262 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000189623 | 1-233 | Protein lin-7 homolog A | |||
Sequence: MLKPSVTSAPTADMATLTVVQPLTLDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNGCPEFRARATAKATVAAFAASEGHSHPRVVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEEMEARFEKLRTARRRQQQQLLIQQQQQQQQQQTQQNHMS |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in brain, testis, kidney, placenta and liver.
Gene expression databases
Organism-specific databases
Interaction
Subunit
Forms a complex with CASK and CASKIN1 (By similarity).
Component of the brain-specific heterotrimeric complex (LIN-10-LIN-2-LIN-7 complex) composed of at least APBA1, CASK, and LIN7, which associates with the motor protein KIF17 to transport vesicles along microtubules (By similarity).
Can also interact with other modular proteins containing protein-protein interaction domains like PALS1, PALS2, MPP7, DLG1, DLG2 and DLG3 through its L27 domain. Interacts with DLG4, GRIN2B and MARCHF11 as well as CDH1 and CTNNB1, the channels KCNJ12/Kir2.2, KCNJ4/Kir2.3 and probably KCNJ2/Kir2.1 and SLC6A12/BGT-1 via its PDZ domain. The association of LIN7A with cadherin and beta-catenin is calcium-dependent, occurs at synaptic junctions and requires the actin cytoskeleton. Interacts with EGFR, ERBB2, ERBB3 and ERBB4 with both PDZ and KID domains. Associates with KIF17 via APBA1. Interacts with HTR4 (By similarity).
Forms a tripartite complex composed of DLG1, MPP7 and LIN7 (LIN7A or LIN7C)
Component of the brain-specific heterotrimeric complex (LIN-10-LIN-2-LIN-7 complex) composed of at least APBA1, CASK, and LIN7, which associates with the motor protein KIF17 to transport vesicles along microtubules (By similarity).
Can also interact with other modular proteins containing protein-protein interaction domains like PALS1, PALS2, MPP7, DLG1, DLG2 and DLG3 through its L27 domain. Interacts with DLG4, GRIN2B and MARCHF11 as well as CDH1 and CTNNB1, the channels KCNJ12/Kir2.2, KCNJ4/Kir2.3 and probably KCNJ2/Kir2.1 and SLC6A12/BGT-1 via its PDZ domain. The association of LIN7A with cadherin and beta-catenin is calcium-dependent, occurs at synaptic junctions and requires the actin cytoskeleton. Interacts with EGFR, ERBB2, ERBB3 and ERBB4 with both PDZ and KID domains. Associates with KIF17 via APBA1. Interacts with HTR4 (By similarity).
Forms a tripartite complex composed of DLG1, MPP7 and LIN7 (LIN7A or LIN7C)
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O14910 | CASK O14936 | 7 | EBI-2513988, EBI-1215506 | |
BINARY | O14910 | CASK O14936-4 | 3 | EBI-2513988, EBI-12007726 | |
BINARY | O14910 | CHRD Q9H2X0 | 3 | EBI-2513988, EBI-947551 | |
BINARY | O14910 | ECM1 Q16610 | 3 | EBI-2513988, EBI-947964 | |
BINARY | O14910 | FAM9B Q8IZU0 | 3 | EBI-2513988, EBI-10175124 | |
BINARY | O14910 | GOLGA2 Q08379 | 3 | EBI-2513988, EBI-618309 | |
BINARY | O14910 | MDFI Q99750 | 3 | EBI-2513988, EBI-724076 | |
BINARY | O14910 | MPP2 Q14168-2 | 4 | EBI-2513988, EBI-10181752 | |
BINARY | O14910 | MPP2 Q14168-4 | 7 | EBI-2513988, EBI-14385193 | |
BINARY | O14910 | MPP3 Q13368 | 5 | EBI-2513988, EBI-716157 | |
BINARY | O14910 | MPP7 Q5T2T1 | 9 | EBI-2513988, EBI-2514004 | |
BINARY | O14910 | NOTCH2NLA Q7Z3S9 | 3 | EBI-2513988, EBI-945833 | |
BINARY | O14910 | PALS1 Q8N3R9 | 10 | EBI-2513988, EBI-2513978 | |
BINARY | O14910 | PALS2 Q9NZW5 | 4 | EBI-2513988, EBI-2683764 | |
BINARY | O14910 | ZYX Q15942 | 3 | EBI-2513988, EBI-444225 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for motif, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 14-28 | Kinase interacting site | ||||
Sequence: MATLTVVQPLTLDRD | ||||||
Domain | 25-80 | L27 | ||||
Sequence: LDRDVARAIELLEKLQESGEVPVHKLQSLKKVLQSEFCTAIREVYQYMHETITVNG | ||||||
Domain | 108-190 | PDZ | ||||
Sequence: VVELPKTDEGLGFNVMGGKEQNSPIYISRIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTP |
Domain
The kinase interacting site is required for proper delivery of ERBB2 to the basolateral membrane.
The PDZ domain regulates endocytosis and recycling of the receptor at the membrane.
The L27 domain mediates interaction with CASK and is involved in the formation of multimeric complexes and the association of LIN7 to membranes.
Sequence similarities
Belongs to the lin-7 family.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length233
- Mass (Da)25,997
- Last updated1999-05-01 v2
- ChecksumD8D05EF16A93BE7B
Computationally mapped potential isoform sequences
There are 3 potential isoforms mapped to this entry
Features
Showing features for sequence conflict.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Sequence conflict | 157 | in Ref. 3; CAG28608 | ||||
Sequence: S → P |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF087693 EMBL· GenBank· DDBJ | AAC78481.1 EMBL· GenBank· DDBJ | mRNA | ||
AF173081 EMBL· GenBank· DDBJ | AAD48500.1 EMBL· GenBank· DDBJ | mRNA | ||
CR407680 EMBL· GenBank· DDBJ | CAG28608.1 EMBL· GenBank· DDBJ | mRNA | ||
AK315321 EMBL· GenBank· DDBJ | BAG37724.1 EMBL· GenBank· DDBJ | mRNA | ||
BC099921 EMBL· GenBank· DDBJ | AAH99921.1 EMBL· GenBank· DDBJ | mRNA | ||
BC118609 EMBL· GenBank· DDBJ | AAI18610.1 EMBL· GenBank· DDBJ | mRNA | ||
BC122561 EMBL· GenBank· DDBJ | AAI22562.1 EMBL· GenBank· DDBJ | mRNA | ||
AF028826 EMBL· GenBank· DDBJ | AAB84251.1 EMBL· GenBank· DDBJ | mRNA |