O14904 · WNT9A_HUMAN
- ProteinProtein Wnt-9a
- GeneWNT9A
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids365 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Ligand for members of the frizzled family of seven transmembrane receptors. Functions in the canonical Wnt/beta-catenin signaling pathway. Required for normal timing of IHH expression during embryonic bone development, normal chondrocyte maturation and for normal bone mineralization during embryonic bone development. Plays a redundant role in maintaining joint integrity.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | extracellular region | |
Cellular Component | extracellular space | |
Molecular Function | cytokine activity | |
Molecular Function | frizzled binding | |
Molecular Function | receptor ligand activity | |
Biological Process | canonical Wnt signaling pathway | |
Biological Process | cell fate commitment | |
Biological Process | cellular response to retinoic acid | |
Biological Process | cornea development in camera-type eye | |
Biological Process | embryonic skeletal joint development | |
Biological Process | iris morphogenesis | |
Biological Process | negative regulation of cell population proliferation | |
Biological Process | negative regulation of chondrocyte differentiation | |
Biological Process | neuron differentiation |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameProtein Wnt-9a
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Primates > Haplorrhini > Catarrhini > Hominidae > Homo
Accessions
- Primary accessionO14904
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Keywords
- Cellular component
Disease & Variants
Features
Showing features for natural variant.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Natural variant | VAR_052956 | 260 | in dbSNP:rs8192633 | |||
Sequence: A → T |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 446 variants from UniProt as well as other sources including ClinVar and dbSNP.
Organism-specific databases
Miscellaneous
Genetic variation databases
PTM/Processing
Features
Showing features for signal, chain, disulfide bond, glycosylation, lipidation.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-29 | |||||
Sequence: MLDGSPLARWLAAAFGLTLLLAALRPSAA | ||||||
Chain | PRO_0000041455 | 30-365 | Protein Wnt-9a | |||
Sequence: YFGLTGSEPLTILPLTLEPEAAAQAHYKACDRLKLERKQRRMCRRDPGVAETLVEAVSMSALECQFQFRFERWNCTLEGRYRASLLKRGFKETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDLENREAWQWGGCGDNLKYSSKFVKEFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKCHGVSGSCTVRTCWRQLAPFHEVGKHLKHKYETALKVGSTTNEAAGEAGAISPPRGRASGAGGSDPLPRTPELVHLDDSPSFCLAGRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEVYTCKG | ||||||
Disulfide bond | 93↔104 | |||||
Sequence: CQFQFRFERWNC | ||||||
Glycosylation | 103 | N-linked (GlcNAc...) asparagine | ||||
Sequence: N | ||||||
Disulfide bond | 141↔149 | |||||
Sequence: CSAGRMERC | ||||||
Disulfide bond | 151↔168 | |||||
Sequence: CDEAPDLENREAWQWGGC | ||||||
Disulfide bond | 215↔229 | |||||
Sequence: CKCHGVSGSCTVRTC | ||||||
Disulfide bond | 217↔224 | |||||
Sequence: CHGVSGSC | ||||||
Lipidation | 221 | O-palmitoleoyl serine; by PORCN | ||||
Sequence: S | ||||||
Disulfide bond | 299↔324 | |||||
Sequence: CLAGRFSPGTAGRRCHREKNCESICC | ||||||
Disulfide bond | 313↔319 | |||||
Sequence: CHREKNC | ||||||
Disulfide bond | 323↔363 | |||||
Sequence: CCGRGHNTQSRVVTRPCQCQVRWCCYVECRQCTQREEVYTC | ||||||
Disulfide bond | 339↔354 | |||||
Sequence: CQCQVRWCCYVECRQC | ||||||
Disulfide bond | 341↔351 | |||||
Sequence: CQVRWCCYVEC | ||||||
Disulfide bond | 346↔347 | |||||
Sequence: CC |
Post-translational modification
Palmitoleoylation is required for efficient binding to frizzled receptors. Depalmitoleoylation leads to Wnt signaling pathway inhibition.
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Interaction
Subunit
Forms a soluble 1:1 complex with AFM; this prevents oligomerization and is required for prolonged biological activity (PubMed:26902720).
The complex with AFM may represent the physiological form in body fluids (PubMed:26902720).
The complex with AFM may represent the physiological form in body fluids (PubMed:26902720).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O14904 | ZBTB14 O43829 | 3 | EBI-12053451, EBI-10176632 |
Protein-protein interaction databases
Miscellaneous
Structure
Family & Domains
Features
Showing features for region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 260-287 | Disordered | ||||
Sequence: AAGEAGAISPPRGRASGAGGSDPLPRTP |
Sequence similarities
Belongs to the Wnt family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length365
- Mass (Da)40,320
- Last updated2002-05-10 v2
- Checksum1E1284D744C6A9B2
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AB060283 EMBL· GenBank· DDBJ | BAB61051.1 EMBL· GenBank· DDBJ | mRNA | ||
AL360269 EMBL· GenBank· DDBJ | - | Genomic DNA | No translation available. | |
CH471098 EMBL· GenBank· DDBJ | EAW69821.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
BC111960 EMBL· GenBank· DDBJ | AAI11961.1 EMBL· GenBank· DDBJ | mRNA | ||
BC113431 EMBL· GenBank· DDBJ | AAI13432.1 EMBL· GenBank· DDBJ | mRNA | ||
AF028702 EMBL· GenBank· DDBJ | AAC39550.1 EMBL· GenBank· DDBJ | Genomic DNA |