O12989 · O12989_DANRE
- ProteinZona pellucida sperm-binding protein 3
- Genezp3b
- StatusUniProtKB unreviewed (TrEMBL)
- Amino acids532 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score3/5
Function
function
Component of the zona pellucida, an extracellular matrix surrounding oocytes which mediates sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy. The zona pellucida is composed of 3 to 4 glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP3 is essential for sperm binding and zona matrix formation.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | egg coat | |
Cellular Component | extracellular matrix | |
Cellular Component | extracellular region | |
Cellular Component | plasma membrane | |
Molecular Function | acrosin binding | |
Molecular Function | structural constituent of egg coat | |
Biological Process | binding of sperm to zona pellucida | |
Biological Process | egg coat formation | |
Biological Process | positive regulation of acrosome reaction |
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameZona pellucida sperm-binding protein 3
Gene names
Organism names
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Actinopterygii > Neopterygii > Teleostei > Ostariophysi > Cypriniformes > Danionidae > Danioninae > Danio
Accessions
- Primary accessionO12989
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Single-pass type I membrane protein
Keywords
- Cellular component
PTM/Processing
Features
Showing features for signal, chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Signal | 1-21 | |||||
Sequence: MGFSNTLAWFISVFLIAECFS | ||||||
Chain | PRO_5035035833 | 22-532 | Zona pellucida sperm-binding protein 3 | |||
Sequence: RVHHGPHHHRGGSSVSQQLLSTQFQAAVPQFQAAVSQFQAAVPKFQAAVPQFQVTIPQIKETPLTDPVPPQAVIVYCRAEAIELVINPDLLAGGLPVFAEELWLGPEASPTCGVVSTGPGPLTIRASLQDCGTQLSVNADSLLYSNVVVYSPLPSPDGVIYTNGAAIPVQCQYRRRYSVDSAAVRPAWVPFDASVSATDYLDFSLRLMTDDWQFERGSNVFFLGDEIHLQAAVRLAYHLPLLVFIDWCVATPTPDVDASEVKYSFIKHHGCLADSRSPNSNSMFMRRTEGNHLNLQLDAFRFHKFTGNLVYIHCHMKAIPAAYSVSAKNRACSFIDQRWRSVDGNDDVCNTCEPSKPVGSEPEQLFHIALTSPVQQPNLAPKPGPAGFFNVRPGQSVEPFNALIQSKSPAFGGLSKRGTDSNKEWMKFATVGPLLLKSKQETSVQSAGGPRFGLDNVFAASFVEKPVFNFTEMRPVEDELEPAPRFRSFSPLQKSIFNVSDLFNSEGSGFE |
Post-translational modification
Proteolytically cleaved before the transmembrane segment to yield the secreted ectodomain incorporated in the zona pellucida.
Keywords
- PTM
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 97-360 | ZP | ||||
Sequence: YCRAEAIELVINPDLLAGGLPVFAEELWLGPEASPTCGVVSTGPGPLTIRASLQDCGTQLSVNADSLLYSNVVVYSPLPSPDGVIYTNGAAIPVQCQYRRRYSVDSAAVRPAWVPFDASVSATDYLDFSLRLMTDDWQFERGSNVFFLGDEIHLQAAVRLAYHLPLLVFIDWCVATPTPDVDASEVKYSFIKHHGCLADSRSPNSNSMFMRRTEGNHLNLQLDAFRFHKFTGNLVYIHCHMKAIPAAYSVSAKNRACSFIDQRW |
Domain
The ZP domain is involved in the polymerization of the ZP proteins to form the zona pellucida.
Sequence similarities
Belongs to the ZP domain family. ZPC subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length532
- Mass (Da)58,405
- Last updated2000-05-01 v3
- Checksum083006A0482C7219
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
U55863 EMBL· GenBank· DDBJ | AAC36365.2 EMBL· GenBank· DDBJ | mRNA |