O08837 · CDC5L_RAT
- ProteinCell division cycle 5-like protein
- GeneCdc5l
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids802 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
DNA-binding protein involved in cell cycle control. May act as a transcription activator. Plays a role in pre-mRNA splicing as core component of precatalytic, catalytic and postcatalytic spliceosomal complexes. Component of the PRP19-CDC5L complex that forms an integral part of the spliceosome and is required for activating pre-mRNA splicing. The PRP19-CDC5L complex may also play a role in the response to DNA damage (DDR). As a component of the minor spliceosome, involved in the splicing of U12-type introns in pre-mRNAs.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 31-54 | H-T-H motif | ||||
Sequence: WSRIASLLHRKSAKQCKARWYEWL | ||||||
DNA binding | 82-104 | H-T-H motif | ||||
Sequence: WRTIAPIIGRTAAQCLEHYEFLL |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameCell division cycle 5-like protein
- Alternative names
Gene names
Organism names
- Organism
- Strains
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Rattus
Accessions
- Primary accessionO08837
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: May shuttle between cytoplasm and nucleus.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain, cross-link, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000197093 | 1-802 | Cell division cycle 5-like protein | |||
Sequence: MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDPSIKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKTAQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPIDMDEDELEMLSEARARLANTQGKKAKRKAREKQLEEARRLAALQKRRELRAAGIEIQKKRKKKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFRKLRQQDLDGELRSEKEGRDRKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEVARQTAEESGITNSASSTLLSEYNVTNNSIALRTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGAEGLTPRSGTTPKPVTNATPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREMDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKNVGFATNNSEHITYLEHSPYEKFSKEDLKKAQDVLVQEMEVVKQGMSHGELSSEAYNQVWEECYSQVLYLPAQSRYTRANLASKKDRIESLEKRLEINRGHMTTEAKRAAKMEKKMKILLGGYQSRAMGLLKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQQRYADLLMEKETLQAKF | ||||||
Cross-link | 135 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 219 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 227 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 303 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 358 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 377 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 385 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 396 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 404 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 411 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 415 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 417 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 424 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 430 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 438 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 442 | Phosphothreonine | ||||
Sequence: T | ||||||
Cross-link | 487 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K |
Post-translational modification
Phosphorylated on serine and threonine residues. Phosphorylation on Thr-411 and Thr-438 is required for CDC5L-mediated mRNA splicing. Has no effect on subcellular location nor on homodimerization. Phosphorylated in vitro by CDK2 (By similarity).
Phosphorylation enhances interaction with PPP1R8
Phosphorylation enhances interaction with PPP1R8
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Induction
By prolactin, IL-2 and FGF-2 in prolactin-dependent lymphoid cells (at protein level).
Gene expression databases
Interaction
Subunit
Homodimer. Interacts with DAPK3 (PubMed:11884640).
Component of the precatalytic, catalytic and postcatalytic spliceosome complexes (By similarity).
Part of a spliceosomal 'core' complex consisting of CDC5L, PLRG1, SPF27, CCAP1, CCAP3 and CCAP6. Interacts with PLRG1, Lodestar/TTF2, and NIPP1/PPP1R8 (PubMed:10827081).
Identified in the spliceosome C complex. Component of the minor spliceosome, which splices U12-type introns. Within this complex, interacts with SCNM1 (By similarity).
Component of the PRP19-CDC5L splicing complex composed of a core complex comprising a homotetramer of PRPF19, CDC5L, PLRG1 and BCAS2, and at least three less stably associated proteins CTNNBL1, CWC15 and HSPA8. Interacts (via its C-terminus) directly in the complex with PRPF19 and BCAS2. Interacts (via its C-terminus) directly with PRGL1 (via its WD40 repeat domain); the interaction is required for mRNA splicing but not for spliceosome assembly. Also interacts with CTNNBL1. Interacts with PRPF19 (via N-terminus) (PubMed:16352598).
Interacts with USB1 (By similarity).
Component of the precatalytic, catalytic and postcatalytic spliceosome complexes (By similarity).
Part of a spliceosomal 'core' complex consisting of CDC5L, PLRG1, SPF27, CCAP1, CCAP3 and CCAP6. Interacts with PLRG1, Lodestar/TTF2, and NIPP1/PPP1R8 (PubMed:10827081).
Identified in the spliceosome C complex. Component of the minor spliceosome, which splices U12-type introns. Within this complex, interacts with SCNM1 (By similarity).
Component of the PRP19-CDC5L splicing complex composed of a core complex comprising a homotetramer of PRPF19, CDC5L, PLRG1 and BCAS2, and at least three less stably associated proteins CTNNBL1, CWC15 and HSPA8. Interacts (via its C-terminus) directly in the complex with PRPF19 and BCAS2. Interacts (via its C-terminus) directly with PRGL1 (via its WD40 repeat domain); the interaction is required for mRNA splicing but not for spliceosome assembly. Also interacts with CTNNBL1. Interacts with PRPF19 (via N-terminus) (PubMed:16352598).
Interacts with USB1 (By similarity).
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain, compositional bias, region, coiled coil, motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 1-56 | HTH myb-type 1 | ||||
Sequence: MPRIMIKGGVWRNTEDEILKAAVMKYGKNQWSRIASLLHRKSAKQCKARWYEWLDP | ||||||
Domain | 57-108 | HTH myb-type 2 | ||||
Sequence: SIKKTEWSREEEEKLLHLAKLMPTQWRTIAPIIGRTAAQCLEHYEFLLDKTA | ||||||
Compositional bias | 108-142 | Basic and acidic residues | ||||
Sequence: AQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPI | ||||||
Region | 108-143 | Disordered | ||||
Sequence: AQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPID | ||||||
Coiled coil | 146-192 | |||||
Sequence: EDELEMLSEARARLANTQGKKAKRKAREKQLEEARRLAALQKRRELR | ||||||
Motif | 165-271 | Nuclear localization signal | ||||
Sequence: KKAKRKAREKQLEEARRLAALQKRRELRAAGIEIQKKRKKKRGVDYNAEIPFEKKPALGFYDTSEENYQALDADFRKLRQQDLDGELRSEKEGRDRKKDKQHLKRKK | ||||||
Region | 200-206 | Required for interaction with CTNNBL1 | ||||
Sequence: KKRKKKR | ||||||
Compositional bias | 246-261 | Basic and acidic residues | ||||
Sequence: DLDGELRSEKEGRDRK | ||||||
Region | 246-278 | Disordered | ||||
Sequence: DLDGELRSEKEGRDRKKDKQHLKRKKESDLPSA | ||||||
Region | 260-606 | Interaction with PPP1R8 | ||||
Sequence: RKKDKQHLKRKKESDLPSAILQTSGVSEFTKKRSKLVLPAPQISDAELQEVVKVGQASEVARQTAEESGITNSASSTLLSEYNVTNNSIALRTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQVVQTPNTVLSTPFRTPSNGAEGLTPRSGTTPKPVTNATPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREMDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKNVGFA | ||||||
Compositional bias | 408-437 | Polar residues | ||||
Sequence: VLSTPFRTPSNGAEGLTPRSGTTPKPVTNA | ||||||
Region | 408-460 | Disordered | ||||
Sequence: VLSTPFRTPSNGAEGLTPRSGTTPKPVTNATPGRTPLRDKLNINPEDGMADYS | ||||||
Region | 501-659 | Interaction with DAPK3 | ||||
Sequence: ELEEREMDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILRPLNVEPPLTDLQKSEELIKKEMITMLHYDLLHHPYEPSGNKKGKNVGFATNNSEHITYLEHSPYEKFSKEDLKKAQDVLVQEMEVVKQGMSHGELSSEAYNQ | ||||||
Coiled coil | 676-701 | |||||
Sequence: RYTRANLASKKDRIESLEKRLEINRG | ||||||
Region | 706-800 | Interaction with PLRG1 | ||||
Sequence: EAKRAAKMEKKMKILLGGYQSRAMGLLKQLNDLWDQIEQAHLELRTFEELKKHEDSAIPRRLECLKEDVQRQQEREKELQQRYADLLMEKETLQA | ||||||
Coiled coil | 761-801 | |||||
Sequence: SAIPRRLECLKEDVQRQQEREKELQQRYADLLMEKETLQAK |
Sequence similarities
Belongs to the CEF1 family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length802
- Mass (Da)92,218
- Last updated2000-05-01 v2
- Checksum3795F3D37E10FCC8
Computationally mapped potential isoform sequences
There are 2 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
A0A8I6A562 | A0A8I6A562_RAT | Cdc5l | 805 | ||
A0A8I5ZNY5 | A0A8I5ZNY5_RAT | Cdc5l | 735 |
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 108-142 | Basic and acidic residues | ||||
Sequence: AQRDNEEETTDDPRKLKPGEIDPNPETKPARPDPI | ||||||
Compositional bias | 246-261 | Basic and acidic residues | ||||
Sequence: DLDGELRSEKEGRDRK | ||||||
Compositional bias | 408-437 | Polar residues | ||||
Sequence: VLSTPFRTPSNGAEGLTPRSGTTPKPVTNA |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF000578 EMBL· GenBank· DDBJ | AAD05365.2 EMBL· GenBank· DDBJ | mRNA |