O08696 · FOXM1_MOUSE
- ProteinForkhead box protein M1
- GeneFoxm1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids760 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Transcription factor regulating the expression of cell cycle genes essential for DNA replication and mitosis (By similarity).
Plays a role in the control of cell proliferation (By similarity).
Also plays a role in DNA break repair, participating in the DNA damage checkpoint response (PubMed:17101782).
Promotes transcription of PHB2 (By similarity).
Plays a role in the control of cell proliferation (By similarity).
Also plays a role in DNA break repair, participating in the DNA damage checkpoint response (PubMed:17101782).
Promotes transcription of PHB2 (By similarity).
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 233-325 | Fork-head | ||||
Sequence: ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRHLTLDQVFKPL |
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameForkhead box protein M1
- Alternative names
Gene names
Organism names
- Organism
- Taxonomic lineageEukaryota > Metazoa > Chordata > Craniata > Vertebrata > Euteleostomi > Mammalia > Eutheria > Euarchontoglires > Glires > Rodentia > Myomorpha > Muroidea > Muridae > Murinae > Mus > Mus
Accessions
- Primary accessionO08696
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain, cross-link, modified residue.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000091864 | 1-760 | Forkhead box protein M1 | |||
Sequence: MRTSPRRPLILKRRRLPLPVQNAPSETSEEEAKRSPAQPEPAPAQASQEVAESSSCKFPAGIKIINHPTTPNTQVVAIPSNADIQSIITALTAKGKESGTSGPNRFILISSGGPSSHPSQPQAHSSRDSKRAEVITETLGPKPAAKGVPVPKPPGAPPRQRQESYAGGEAAGCTLDNSLTNIQWLGKMSSDGLGPCSVKQELEEKENCHLEQNRVKVEEPSGVSTSWQDSVSERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRHLTLDQVFKPLEPGSPQSPEHLESQQKRPNPELHRNVTIKTEIPLGARRKMKPLLPRVSSYLEPIQFPVNQSLVLQPSVKVPFRLAASLMSSELARHSKRVRIAPKVLLSSEGIAPLPATEPPKEEKPLLGGEGLLPLLPIQSIKEEEMQPEEDIAHLERPIKVESPPLEEWPSPCASLKEELSNSWEDSSCSPTPKPKKSYCGLKSPTRCVSEMLVTKRREKREVSRSRRKQHLQPPCLDEPDLFFPEDSSTFRPAVELLAESSEPAPHLSCPQEEGGPFKTPIKETLPVSSTPSKSVLSRDPESWRLTPPAKVGGLDFSPVRTPQGAFGLLPDSLGLMELNTTPLKSGPLFDSPRELLNSEPFDLASDPFGSPPPPHVEGPKPGSPELQIPSLSANRSLTEGLVLDTMNDSLSKILLDISFPGLEEDPLGPDNINWSQFIPELR | ||||||
Cross-link | 199 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 323 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 329 | Phosphoserine | ||||
Sequence: S | ||||||
Cross-link | 354 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 374 | Phosphoserine; by CHEK2 | ||||
Sequence: S | ||||||
Cross-link | 420 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Cross-link | 438 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2) | ||||
Sequence: K | ||||||
Modified residue | 521 | Phosphoserine | ||||
Sequence: S | ||||||
Modified residue | 608 | Phosphothreonine; by CDK1 | ||||
Sequence: T | ||||||
Modified residue | 624 | Phosphothreonine | ||||
Sequence: T | ||||||
Modified residue | 727 | Phosphoserine; by PLK1 | ||||
Sequence: S | ||||||
Modified residue | 736 | Phosphoserine; by PLK1 | ||||
Sequence: S |
Post-translational modification
Phosphorylated in M (mitotic) phase. Phosphorylation by the checkpoint kinase CHEK2 in response to DNA damage increases the FOXM1 protein stability probably stimulating the transcription of genes involved in DNA repair. Phosphorylated by CDK1 in late S and G2 phases, creating docking sites for the POLO box domains of PLK1. Subsequently, PLK1 binds and phosphorylates FOXM1, leading to activation of transcriptional activity and subsequent enhanced expression of key mitotic regulators (By similarity).
Keywords
- PTM
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in fetal heart, brain, liver, lung, kidney and limb, but only in adult thymus. Appears to be expressed only in adult organs containing proliferating/cycling cells or in response to growth factors.
Developmental stage
Expressed at 14 dpc in the embryo.
Structure
Family & Domains
Features
Showing features for region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-54 | Disordered | ||||
Sequence: MRTSPRRPLILKRRRLPLPVQNAPSETSEEEAKRSPAQPEPAPAQASQEVAESS | ||||||
Compositional bias | 95-123 | Polar residues | ||||
Sequence: GKESGTSGPNRFILISSGGPSSHPSQPQA | ||||||
Region | 95-167 | Disordered | ||||
Sequence: GKESGTSGPNRFILISSGGPSSHPSQPQAHSSRDSKRAEVITETLGPKPAAKGVPVPKPPGAPPRQRQESYAG | ||||||
Region | 323-348 | Disordered | ||||
Sequence: KPLEPGSPQSPEHLESQQKRPNPELH | ||||||
Region | 500-560 | Disordered | ||||
Sequence: SWEDSSCSPTPKPKKSYCGLKSPTRCVSEMLVTKRREKREVSRSRRKQHLQPPCLDEPDLF | ||||||
Compositional bias | 529-552 | Basic and acidic residues | ||||
Sequence: MLVTKRREKREVSRSRRKQHLQPP | ||||||
Region | 577-635 | Disordered | ||||
Sequence: ESSEPAPHLSCPQEEGGPFKTPIKETLPVSSTPSKSVLSRDPESWRLTPPAKVGGLDFS | ||||||
Compositional bias | 601-617 | Polar residues | ||||
Sequence: ETLPVSSTPSKSVLSRD | ||||||
Region | 660-709 | Disordered | ||||
Sequence: PLKSGPLFDSPRELLNSEPFDLASDPFGSPPPPHVEGPKPGSPELQIPSL | ||||||
Compositional bias | 684-698 | Pro residues | ||||
Sequence: DPFGSPPPPHVEGPK |
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length760
- Mass (Da)83,694
- Last updated2000-12-01 v2
- ChecksumAA614CB940EE7492
Computationally mapped potential isoform sequences
There are 4 potential isoforms mapped to this entry
Entry | Entry name | Gene name | Length | ||
---|---|---|---|---|---|
Q6P1H7 | Q6P1H7_MOUSE | Foxm1 | 757 | ||
E9Q7Y0 | E9Q7Y0_MOUSE | Foxm1 | 742 | ||
A0A0N4SWD2 | A0A0N4SWD2_MOUSE | Foxm1 | 214 | ||
A0A0N4SVY9 | A0A0N4SVY9_MOUSE | Foxm1 | 402 |
Sequence caution
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 95-123 | Polar residues | ||||
Sequence: GKESGTSGPNRFILISSGGPSSHPSQPQA | ||||||
Compositional bias | 529-552 | Basic and acidic residues | ||||
Sequence: MLVTKRREKREVSRSRRKQHLQPP | ||||||
Compositional bias | 601-617 | Polar residues | ||||
Sequence: ETLPVSSTPSKSVLSRD | ||||||
Compositional bias | 684-698 | Pro residues | ||||
Sequence: DPFGSPPPPHVEGPK |
Keywords
- Technical term