O04468 · STMP6_ARATH
- ProteinSecreted transmembrane peptide 6
- GeneSTMP6
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids
- Protein existenceEvidence at transcript level
- Annotation score5/5
Function
function
Brassicaceae-specific phytocytokine (plant endogenous peptide released into the apoplast) perceived by MIK2 in a BAK1/SERK3 and SERK4 coreceptors-dependent manner, that modulates various physiological and antimicrobial processes including growth prevention and reactive oxygen species (ROS) response regulation (By similarity).
Prevents general growth and development (PubMed:31001913).
Prevents general growth and development (PubMed:31001913).
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | apoplast | |
Cellular Component | plasma membrane | |
Molecular Function | LRR domain binding | |
Molecular Function | receptor serine/threonine kinase binding | |
Biological Process | response to bacterium | |
Biological Process | response to cold | |
Biological Process | response to ethylene | |
Biological Process | response to jasmonic acid | |
Biological Process | response to salicylic acid | |
Biological Process | response to salt stress | |
Biological Process | response to water deprivation |
Names & Taxonomy
Protein names
- Recommended nameSecreted transmembrane peptide 6
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionO04468
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: The precursor of STMP6 accumulates at the plasma membrane and is proteolytically cleaved to release the STMP6 in the apoplasm.
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
Slightly increased growth and fresh weight.
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 9 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for peptide, signal, propeptide.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Peptide | PRO_0000457267 | ?-86 | Secreted transmembrane peptide 6 | |||
Sequence: MGMKSPNIAAFMLPLLLILFTLSSQLKVVESTGRKLAWGFSGTPIVYTPPSRSCGTSPAVFTSKWRRPRPCRLPPGSYIPASDQSP | ||||||
Signal | 1-31 | |||||
Sequence: MGMKSPNIAAFMLPLLLILFTLSSQLKVVES | ||||||
Propeptide | PRO_0000457266 | 32-? | Removed in mature form | |||
Sequence: MGMKSPNIAAFMLPLLLILFTLSSQLKVVES |
Keywords
- PTM
Proteomic databases
Expression
Tissue specificity
Mostly expressed in leaves, and, to a lower extent, in roots, stems, siliques, seeds and flowers.
Induction
Induced by cold, drought and salt stress, but repressed by pathogenic bacteria Pseudomonas syringae pv. tomato (Pst) DC3000, jasmonate (MeJA), ethylene (ET) and salicylic acid (SA), mainly in shoots.
Gene expression databases
Interaction
Subunit
Interacts with MIK2 (via extracellular leucine-rich repeat domain); this interaction triggers the formation of complex between MIK2 and the BAK1/SERK3 and SERK4 coreceptors, and subsequent BAK1 activation by phosphorylation.
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for motif.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Motif | 45-58 | SCOOP motif | ||||
Sequence: IVYTPPSRSCGTSP | ||||||
Motif | 51-53 | SxS motif essential for MIK2 binding | ||||
Sequence: SRS |
Sequence similarities
Belongs to the serine rich endogenous peptide (SCOOP) phytocytokine family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Sequence processingThe displayed sequence is further processed into a mature form.
- Length86
- Mass (Da)9,352
- Last updated1997-07-01 v1
- Checksum72778DB73973C0E5
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AC001229 EMBL· GenBank· DDBJ | AAB60905.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002684 EMBL· GenBank· DDBJ | AEE34390.1 EMBL· GenBank· DDBJ | Genomic DNA |