O04291 · ATB14_ARATH
- ProteinHomeobox-leucine zipper protein ATHB-14
- GeneATHB-14
- StatusUniProtKB reviewed (Swiss-Prot)
- Amino acids852 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Probable transcription factor involved in the determination of adaxial-abaxial polarity in ovule primordium. Specifies adaxial leaf fates.
Activity regulation
Inhibited by ZPR3.
Features
Showing features for dna binding.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
DNA binding | 22-85 | Homeobox | ||||
Sequence: DSGKYVRYTPEQVEALERVYTECPKPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRK |
GO annotations
all annotations | all molecular function | nucleotide binding | molecular_function | nucleic acid binding | dna binding | chromatin binding | dna-binding transcription factor activity | rna binding | cytoskeletal motor activity | catalytic activity | nuclease activity | signaling receptor binding | structural molecule activity | transporter activity | binding | protein binding | translation factor activity, rna binding | lipid binding | kinase activity | transferase activity | hydrolase activity | oxygen binding | enzyme regulator activity | carbohydrate binding | signaling receptor activity | translation regulator activity | transcription regulator activity | other molecular function | all biological process | carbohydrate metabolic process | generation of precursor metabolites and energy | nucleobase-containing compound metabolic process | dna metabolic process | translation | lipid metabolic process | transport | response to stress | cell cycle | cell communication | signal transduction | cell-cell signaling | multicellular organism development | circadian rhythm | biological_process | metabolic process | catabolic process | biosynthetic process | response to light stimulus | response to external stimulus | tropism | response to biotic stimulus | response to abiotic stimulus | response to endogenous stimulus | embryo development | post-embryonic development | fruit ripening | abscission | pollination | flower development | cellular process | programmed cell death | photosynthesis | cellular component organization | cell growth | protein metabolic process | cellular homeostasis | secondary metabolic process | reproductive process | cell differentiation | protein modification process | growth | epigenetic regulation of gene expression | response to chemical | anatomical structure development | regulation of molecular function | other biological process | all cellular component | cellular_component | extracellular region | cell wall | intracellular anatomical structure | nucleus | nuclear envelope | nucleoplasm | nucleolus | cytoplasm | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | cytosol | ribosome | cytoskeleton | plasma membrane | chloroplast | plastid | thylakoid | membrane | external encapsulating structure | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | nucleus | |
Molecular Function | DNA binding | |
Molecular Function | DNA-binding transcription factor activity | |
Molecular Function | lipid binding | |
Biological Process | adaxial/abaxial pattern specification | |
Biological Process | cell differentiation | |
Biological Process | determination of bilateral symmetry | |
Biological Process | integument development | |
Biological Process | meristem initiation | |
Biological Process | polarity specification of adaxial/abaxial axis | |
Biological Process | primary shoot apical meristem specification |
Keywords
- Molecular function
- Biological process
Names & Taxonomy
Protein names
- Recommended nameHomeobox-leucine zipper protein ATHB-14
- Alternative names
Gene names
Organism names
- Strain
- Taxonomic lineageEukaryota > Viridiplantae > Streptophyta > Embryophyta > Tracheophyta > Spermatophyta > Magnoliopsida > eudicotyledons > Gunneridae > Pentapetalae > rosids > malvids > Brassicales > Brassicaceae > Camelineae > Arabidopsis
Accessions
- Primary accessionO04291
Proteomes
Organism-specific databases
Genome annotation databases
Subcellular Location
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 202 | In phb-3d, phb-4d and phb-5d; constitutively active. Transformation of abaxial leaf fates into adaxial leaf fates. | ||||
Sequence: G → D |
Variants
We now provide the "Disease & Variants" viewer in its own tab.
The viewer provides 60 variants from UniProt as well as other sources including ClinVar and dbSNP.
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000331660 | 1-852 | Homeobox-leucine zipper protein ATHB-14 | |||
Sequence: MMMVHSMSRDMMNRESPDKGLDSGKYVRYTPEQVEALERVYTECPKPSSLRRQQLIRECPILSNIEPKQIKVWFQNRRCREKQRKEAARLQTVNRKLNAMNKLLMEENDRLQKQVSNLVYENGHMKHQLHTASGTTTDNSCESVVVSGQQHQQQNPNPQHQQRDANNPAGLLSIAEEALAEFLSKATGTAVDWVQMIGMKPGPDSIGIVAISRNCSGIAARACGLVSLEPMKVAEILKDRPSWLRDCRSVDTLSVIPAGNGGTIELIYTQMYAPTTLAAARDFWTLRYSTCLEDGSYVVCERSLTSATGGPTGPPSSNFVRAEMKPSGFLIRPCDGGGSILHIVDHVDLDAWSVPEVMRPLYESSKILAQKMTVAALRHVRQIAQETSGEVQYGGGRQPAVLRTFSQRLCRGFNDAVNGFVDDGWSPMGSDGAEDVTVMINLSPGKFGGSQYGNSFLPSFGSGVLCAKASMLLQNVPPAVLVRFLREHRSEWADYGVDAYAAASLRASPFAVPCARAGGFPSNQVILPLAQTVEHEESLEVVRLEGHAYSPEDMGLARDMYLLQLCSGVDENVVGGCAQLVFAPIDESFADDAPLLPSGFRIIPLEQKSTPNGASANRTLDLASALEGSTRQAGEADPNGCNFRSVLTIAFQFTFDNHSRDSVASMARQYVRSIVGSIQRVALAIAPRPGSNISPISVPTSPEALTLVRWISRSYSLHTGADLFGSDSQTSGDTLLHQLWNHSDAILCCSLKTNASPVFTFANQTGLDMLETTLVALQDIMLDKTLDEPGRKALCSEFPKIMQQGYAHLPAGVCASSMGRMVSYEQATVWKVLEDDESNHCLAFMFVNWSFV |
Proteomic databases
PTM databases
Expression
Tissue specificity
Expressed in the center of the meristem and on the adaxial side of the leaves.
Induction
Repressed by miR165 and miR166.
Developmental stage
Expressed at the youngest stages of ovule development, predominantly to the adaxial side of the ovule primordium. Later, expression becomes restricted to a region in the distal chalaza. When the integuments initiate, expressed in the inner integument, with highest expression in the inner layer of the inner integument. Expressed in the vegetative shoot apical meristem (SAM) and initially throughout the presumptive cotyledons. At the globular stage, just before cotyledon outgrowth, expressed at high levels in cotyledon adaxial domains. Expression is lost from the SAM of torpedo stage embryos but is regained late in embryogenesis, extending to young primordia after germination, and becoming progressively restricted to the adaxial domain and the vasculature. Preferentially expressed in the adaxial domain of the developing leaf. Expressed throughout the plastochron 0 (P0) leaf primordium and expression increases in P1 to become preferentially localized to the adaxial leaf domain by the P2 stage (polar expression).
Gene expression databases
Structure
Family & Domains
Features
Showing features for region, coiled coil, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Region | 1-25 | Disordered | ||||
Sequence: MMMVHSMSRDMMNRESPDKGLDSGK | ||||||
Coiled coil | 80-122 | |||||
Sequence: REKQRKEAARLQTVNRKLNAMNKLLMEENDRLQKQVSNLVYEN | ||||||
Region | 80-130 | ZIP domain | ||||
Sequence: REKQRKEAARLQTVNRKLNAMNKLLMEENDRLQKQVSNLVYENGHMKHQLH | ||||||
Region | 130-166 | Disordered | ||||
Sequence: HTASGTTTDNSCESVVVSGQQHQQQNPNPQHQQRDAN | ||||||
Domain | 164-392 | START | ||||
Sequence: DANNPAGLLSIAEEALAEFLSKATGTAVDWVQMIGMKPGPDSIGIVAISRNCSGIAARACGLVSLEPMKVAEILKDRPSWLRDCRSVDTLSVIPAGNGGTIELIYTQMYAPTTLAAARDFWTLRYSTCLEDGSYVVCERSLTSATGGPTGPPSSNFVRAEMKPSGFLIRPCDGGGSILHIVDHVDLDAWSVPEVMRPLYESSKILAQKMTVAALRHVRQIAQETSGEVQ |
Domain
The ZIP domain (80-130) is necessary and sufficient for the interaction with ZPR3 (PubMed:18408069).
Sequence similarities
Belongs to the HD-ZIP homeobox family. Class III subfamily.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length852
- Mass (Da)93,218
- Last updated1997-07-01 v1
- ChecksumC1802529EFCC4E68
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
Y11122 EMBL· GenBank· DDBJ | CAA72007.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AJ441291 EMBL· GenBank· DDBJ | CAD29659.1 EMBL· GenBank· DDBJ | mRNA | ||
AC003096 EMBL· GenBank· DDBJ | AAC16263.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
CP002685 EMBL· GenBank· DDBJ | AEC09012.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
AY099791 EMBL· GenBank· DDBJ | AAM20642.1 EMBL· GenBank· DDBJ | mRNA | ||
BT000335 EMBL· GenBank· DDBJ | AAN15654.1 EMBL· GenBank· DDBJ | mRNA |