O01798 · SPE8_CAEEL
- ProteinSpermatocyte protein spe-8
- Genespe-8
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids512 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Probable non-receptor tyrosine-protein kinase which plays a role in spermatid activation (spermiogenesis) in hermaphrodites.
Catalytic activity
- L-tyrosyl-[protein] + ATP = O-phospho-L-tyrosyl-[protein] + ADP + H+
Features
Showing features for binding site, active site.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cytoplasm | |
Cellular Component | plasma membrane | |
Molecular Function | ATP binding | |
Molecular Function | non-membrane spanning protein tyrosine kinase activity | |
Molecular Function | signaling receptor binding | |
Biological Process | cell differentiation | |
Biological Process | cell surface receptor protein tyrosine kinase signaling pathway | |
Biological Process | innate immune response | |
Biological Process | protein phosphorylation | |
Biological Process | spermatid development |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSpermatocyte protein spe-8
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionO01798
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Cell membrane ; Peripheral membrane protein
Note: Localizes mainly in the cytoplasm of stage I spermatocytes and at the cell membrane of stage II spermatocytes and spermatids.
Keywords
- Cellular component
Phenotypes & Variants
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 150 | In hc134ts; temperature-sensitive self-sterility in hermaphrodites but normal male fertility. | ||||
Sequence: S → N | ||||||
Mutagenesis | 229 | In hc79; self-sterility in hermaphrodites but normal male fertility. | ||||
Sequence: G → R | ||||||
Mutagenesis | 231 | In hc53; self-sterility in hermaphrodites but normal male fertility. | ||||
Sequence: V → M | ||||||
Mutagenesis | 405 | In hc108; self-sterility in hermaphrodites but normal male fertility. | ||||
Sequence: G → D | ||||||
Mutagenesis | 465 | In hc40; self-sterility in hermaphrodites but normal male fertility. | ||||
Sequence: R → H |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000433988 | 1-512 | Spermatocyte protein spe-8 | |||
Sequence: MRSKSSEGDLQPEDTQSREDKETTATYSEDTKPETQKERNAALDNLAKTPIQLVVQPTPLTPAITPCEAPPPPPPPKPSSDNNNSKRLKVKDQLIEVPSDEVGRVENNIDNFPFYHGFMGRNECEAMLSNHGDFLIRMTEIGKRVAYVISIKWKYQNIHVLVKRTKTKKLYWTKKYAFKSICELIAYHKRNHKPIYEGMTLICGLARHGWQLNNEQVTLNKKLGEGQFGEVHKGSLKTSVFAAPVTVAVKTLHQNHLSANEKILFLREANVMLTLSHPNVIKFYGVCTMKEPIMIVMEFCDGKSLEDALLSKEEKVSAEDKILYLFHAACGIDYLHGKQVIHRDIAARNCLLNSKKILKISDFGLSVKGVAIKERKGGCLPVKYMAPETLKKGLYSTASDIYSYGALMYEVYTDGKTPFETCGLRGNELRKAIIGKRISLAVEVELPVFIANIFEQSRQYETEDRISSKQIIQIFKEEVGFHEIETSGILHKLVNSLPRIHNKERKPAAVAV |
Proteomic databases
Expression
Interaction
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for compositional bias, region, domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-41 | Basic and acidic residues | ||||
Sequence: MRSKSSEGDLQPEDTQSREDKETTATYSEDTKPETQKERNA | ||||||
Region | 1-85 | Disordered | ||||
Sequence: MRSKSSEGDLQPEDTQSREDKETTATYSEDTKPETQKERNAALDNLAKTPIQLVVQPTPLTPAITPCEAPPPPPPPKPSSDNNNS | ||||||
Compositional bias | 63-80 | Pro residues | ||||
Sequence: AITPCEAPPPPPPPKPSS | ||||||
Domain | 114-205 | SH2 | ||||
Sequence: FYHGFMGRNECEAMLSNHGDFLIRMTEIGKRVAYVISIKWKYQNIHVLVKRTKTKKLYWTKKYAFKSICELIAYHKRNHKPIYEGMTLICGL | ||||||
Domain | 217-485 | Protein kinase | ||||
Sequence: VTLNKKLGEGQFGEVHKGSLKTSVFAAPVTVAVKTLHQNHLSANEKILFLREANVMLTLSHPNVIKFYGVCTMKEPIMIVMEFCDGKSLEDALLSKEEKVSAEDKILYLFHAACGIDYLHGKQVIHRDIAARNCLLNSKKILKISDFGLSVKGVAIKERKGGCLPVKYMAPETLKKGLYSTASDIYSYGALMYEVYTDGKTPFETCGLRGNELRKAIIGKRISLAVEVELPVFIANIFEQSRQYETEDRISSKQIIQIFKEEVGFHEIE |
Sequence similarities
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length512
- Mass (Da)57,802
- Last updated2001-12-01 v2
- ChecksumE6B44EB28C1D7EB1
Features
Showing features for compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Compositional bias | 1-41 | Basic and acidic residues | ||||
Sequence: MRSKSSEGDLQPEDTQSREDKETTATYSEDTKPETQKERNA | ||||||
Compositional bias | 63-80 | Pro residues | ||||
Sequence: AITPCEAPPPPPPPKPSS |
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
BX284601 EMBL· GenBank· DDBJ | CCD71705.1 EMBL· GenBank· DDBJ | Genomic DNA |