O01757 · NAT10_CAEEL
- ProteinRNA cytidine acetyltransferase
- Genenath-10
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids1043 (go to sequence)
- Protein existenceInferred from homology
- Annotation score3/5
Function
function
RNA cytidine acetyltransferase with specificity toward both 18S rRNA and tRNAs. Catalyzes the formation of N4-acetylcytidine (ac4C) in 18S rRNA. Required for early nucleolar cleavages of precursor rRNA at sites A0, A1 and A2 during 18S rRNA synthesis. Catalyzes the formation of ac4C in serine and leucine tRNAs. Requires a tRNA-binding adapter protein for full tRNA acetyltransferase activity but not for 18S rRNA acetylation. Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associate with the nascent pre-rRNA and work in concert to generate RNA folding, modifications, rearrangements and cleavage as well as targeted degradation of pre-ribosomal RNA by the RNA exosome (By similarity).
Catalytic activity
- a cytidine in 18S rRNA + acetyl-CoA + ATP + H2O = ADP + an N4-acetylcytidine in 18S rRNA + CoA + H+ + phosphate
- a cytidine in tRNA + acetyl-CoA + ATP + H2O = ADP + an N4-acetylcytidine in tRNA + CoA + H+ + phosphate
Features
Showing features for binding site.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Binding site | 285-294 | ATP (UniProtKB | ChEBI) | ||||
Sequence: GRGKSAAVGL | ||||||
Binding site | 462 | ATP (UniProtKB | ChEBI) | ||||
Sequence: R | ||||||
Binding site | 622-624 | acetyl-CoA (UniProtKB | ChEBI) | ||||
Sequence: VAV | ||||||
Binding site | 629-635 | acetyl-CoA (UniProtKB | ChEBI) | ||||
Sequence: QSMGYGG | ||||||
Binding site | 723 | acetyl-CoA (UniProtKB | ChEBI) | ||||
Sequence: R |
GO annotations
Aspect | Term | |
---|---|---|
Cellular Component | nucleolus | |
Cellular Component | small-subunit processome | |
Molecular Function | ATP binding | |
Molecular Function | rRNA cytidine N-acetyltransferase activity | |
Molecular Function | tRNA binding | |
Molecular Function | tRNA N-acetyltransferase activity | |
Biological Process | ribosomal small subunit biogenesis | |
Biological Process | rRNA acetylation involved in maturation of SSU-rRNA | |
Biological Process | tRNA acetylation |
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameRNA cytidine acetyltransferase
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionO01757
Proteomes
Organism-specific databases
Subcellular Location
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000215885 | 1-1043 | RNA cytidine acetyltransferase | |||
Sequence: MRTKLDGRIRTQIENGVASGHRSMFAVVGDKARDQVPILYHILSKSTVSARPNVLWCYKKELSFSTHRAKKAKKMKKATTTISGSLPDADPFDVFISSTQIRYCYYNETEKILGNTFGVLVLQDFEAMTPNLLARTIETIEGGGMVILLMQSVRSLRQLYTISMDVHNRYRTEAHNEITARFNERFILSLASCSSVLVLDDQLRVLPISSHIENVEAIPASQKKIQSESDAELASLKEAMKETKPIGPLLSRARTACQAKALLRFLDVITEKQSNVTCSLTAGRGRGKSAAVGLSLAGAIAFGYTNIFVTSPSPENLKTLFEFVVKGFDALDYQEHTDYELIQSANPEFKNCLVRINVFREHKQTIQYISPTDVQKLGQCELIVIDEAAAIPLPLVKELISGPYISFLSSTINGYEGTGRSLSLKLLQQLRQQSAGGEAKEGKSASNKGKTLHEMHMEESIRYKPGDKIEKWLNRLLCLDATNCQLKLECGTPPPAACELYIVNRDTLFSFHDASEAFLQQVMAIFVSAHYKNSPNDLQMLSDAPAHNLFVLMAPIDKSRKTIPEVLAVVQVCLEGRLDSDNIQNGLESGKRAAGDLLPWTVSQQFMDKQFGTLCGGRIVRVAVHPDYQSMGYGGRAVQLIEQYYLGLATSLDEEEKAPAPPSKTVIKQVKDGHTVELLEERIEPRADLPPLLQRLDERKPERLDYLGVSFGLTVPLLKFWKRNEFVPVYIRQNSNDITGEHTCIILKGLEHGGSDSDEEPSATWLPVYWREFRRRIVNLLSFDFSSFPAQMALSLLQLKNKHVEKQMKRLVIERSELAIHLSNTDLRRMSQYGRNMVDSHIITDILPIVAKLNFEQRLPQELKLAVTQSAILLARGLQHKHFEDISKELDLPMNQIFALLTKAIRRIGDWFDEVCETAVRENLDKEAEASAANKPTSSLPKAVPLANLEDELESAAKEIRARHDRDRKALLAELGNELQKYEIIQDEKELAEAYESVNMKYANKLVSVKSKRTAIQAAIPDAKDPANKNAKKKKRFSSGGRR |
Proteomic databases
Expression
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, region.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 551-736 | N-acetyltransferase | ||||
Sequence: VLMAPIDKSRKTIPEVLAVVQVCLEGRLDSDNIQNGLESGKRAAGDLLPWTVSQQFMDKQFGTLCGGRIVRVAVHPDYQSMGYGGRAVQLIEQYYLGLATSLDEEEKAPAPPSKTVIKQVKDGHTVELLEERIEPRADLPPLLQRLDERKPERLDYLGVSFGLTVPLLKFWKRNEFVPVYIRQNSN | ||||||
Region | 1020-1043 | Disordered | ||||
Sequence: IPDAKDPANKNAKKKKRFSSGGRR |
Sequence similarities
Belongs to the RNA cytidine acetyltransferase family. NAT10 subfamily.
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length1,043
- Mass (Da)116,999
- Last updated1997-07-01 v1
- ChecksumD4AB383C9681A4FF
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
FO080647 EMBL· GenBank· DDBJ | CCD65443.1 EMBL· GenBank· DDBJ | Genomic DNA |