O01498 · STAM1_CAEEL
- ProteinSignal transducing adapter molecule 1
- Genestam-1
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids457 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Binds, sorts and targets the polycystin complex (lov-1 and pkd-2) for lysosomal degradation, acting on early endosomes located at the ciliary base. Functions in the germline together with the ephrin receptor (vab-1) signaling pathway to negatively regulate MAPK activation. May have a role as a positive regulator of meiotic maturation in oocytes, acting independently of vab-1.
GO annotations
all annotations | all molecular function | virus receptor activity | dna binding | rna binding | cytoskeletal motor activity | catalytic activity | gtpase activity | structural molecule activity | transporter activity | cytoskeletal protein binding | lipid binding | cyclase activity | antioxidant activity | oxidoreductase activity | transferase activity | hydrolase activity | lyase activity | isomerase activity | ligase activity | protein tag activity | cargo receptor activity | histone binding | protein folding chaperone | translation regulator activity | nutrient reservoir activity | receptor ligand activity | molecular transducer activity | molecular adaptor activity | toxin activity | cell adhesion mediator activity | molecular function regulator activity | virus coreceptor activity | catalytic activity, acting on a protein | catalytic activity, acting on dna | catalytic activity, acting on rna | molecular carrier activity | transcription regulator activity | general transcription initiation factor activity | molecular sensor activity | molecular sequestering activity | atp-dependent activity | other molecular function | all biological process | mitotic cell cycle | cytokinesis | cytoplasmic translation | immune system process | muscle system process | circulatory system process | renal system process | respiratory system process | carbohydrate metabolic process | generation of precursor metabolites and energy | dna replication | dna repair | dna recombination | chromatin organization | dna-templated transcription | regulation of dna-templated transcription | trna metabolic process | protein folding | protein glycosylation | amino acid metabolic process | modified amino acid metabolic process | lipid metabolic process | vitamin metabolic process | sulfur compound metabolic process | intracellular protein transport | nucleocytoplasmic transport | autophagy | inflammatory response | mitochondrion organization | cytoskeleton organization | microtubule-based movement | peroxisome organization | lysosome organization | chromosome segregation | cell adhesion | establishment or maintenance of cell polarity | programmed cell death | photosynthesis | mrna metabolic process | snrna metabolic process | vesicle-mediated transport | reproductive process | digestive system process | signaling | cell differentiation | protein catabolic process | extracellular matrix organization | regulatory ncrna-mediated gene silencing | telomere organization | cell junction organization | wound healing | ribosome biogenesis | cilium organization | anatomical structure development | cell motility | nervous system process | endocrine process | protein maturation | transmembrane transport | nucleobase-containing small molecule metabolic process | hepaticobiliary system process | membrane organization | protein-containing complex assembly | cell wall organization or biogenesis | nitrogen cycle metabolic process | protein localization to plasma membrane | defense response to other organism | detoxification | meiotic nuclear division | mitotic nuclear division | mitochondrial gene expression | carbohydrate derivative metabolic process | other biological process | all cellular component | nuclear chromosome | extracellular region | extracellular space | cell wall | nucleus | nuclear envelope | nucleoplasm | chromosome | nucleolus | mitochondrion | lysosome | endosome | vacuole | peroxisome | endoplasmic reticulum | golgi apparatus | lipid droplet | microtubule organizing center | cytosol | ribosome | cytoskeleton | plasma membrane | cilium | plastid | thylakoid | external encapsulating structure | extracellular matrix | cytoplasmic vesicle | organelle | other cellular component | |||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Aspect | Term | |
---|---|---|
Cellular Component | cilium | |
Cellular Component | early endosome | |
Cellular Component | endosome | |
Cellular Component | ESCRT-0 complex | |
Molecular Function | phosphatidylinositol binding | |
Molecular Function | ubiquitin binding | |
Biological Process | endosome to lysosome transport | |
Biological Process | ephrin receptor signaling pathway | |
Biological Process | negative regulation of MAPK cascade | |
Biological Process | protein localization to non-motile cilium | |
Biological Process | protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway | |
Biological Process | response to hermaphrodite contact |
Keywords
- Molecular function
- Biological process
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameSignal transducing adapter molecule 1
- Short namesSTAM-1
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionO01498
- Secondary accessions
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Located to early endosomes at the ciliary base but not cilium proper of male-specific sensory neurons.
Keywords
- Cellular component
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000347284 | 1-457 | Signal transducing adapter molecule 1 | |||
Sequence: MKKQKSFPMSAYEDLLGKITAPTITVENWEGILAFCDMINNDFEGSKTGIKSLRKRLNNRDPHVVLLAISVLDSCWANCEERFRKEVSSAQFINELKALCTSSQRQVAEKMRLTVQKWVDTECKTEQSLSLIVTLHKNLVADGYSFVVDDPKSKTKAIDAKFANDPNYVGSAQEEEAIAKAIAASLADAEKQEKAKKSTSTMYPSAKASSPAVQTNSNIPEKNVRALYDFEAAESNELSFVAGDIITITDESNPHWWTGRIGTQQGLFPSSFVTNQLDDLKSKETDSSQKAPEVVASINEAILVRCLQVLHECDPTGERQDPEDLAQLEAASYAQGNLIDAHLASIDRQSNSLAQIDVAIRDVLALYDDAIQKGGFQHQSQGMYQQPMQQYNYQQPPNRAYYPPTGPVQQQQPQQYPPQHYPAPGAQPQYACPPNSVPQPQQQQQQWPAPSSQPQQY |
Proteomic databases
Expression
Tissue specificity
Widely expressed, including the pharyngeal intestinal valve, several head neurons, and phasmids in both males and hermaphrodites throughout development. In males, also expressed in the gonad and sensory neurons in the tail. Expressed in the male-specific ciliate CEM, ray B-type and hook HOB sensory neurons.
Gene expression databases
Structure
Family & Domains
Features
Showing features for domain, region, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 19-147 | VHS | ||||
Sequence: ITAPTITVENWEGILAFCDMINNDFEGSKTGIKSLRKRLNNRDPHVVLLAISVLDSCWANCEERFRKEVSSAQFINELKALCTSSQRQVAEKMRLTVQKWVDTECKTEQSLSLIVTLHKNLVADGYSFV | ||||||
Domain | 173-192 | UIM | ||||
Sequence: QEEEAIAKAIAASLADAEKQ | ||||||
Region | 196-216 | Disordered | ||||
Sequence: KKSTSTMYPSAKASSPAVQTN | ||||||
Compositional bias | 198-216 | Polar residues | ||||
Sequence: STSTMYPSAKASSPAVQTN | ||||||
Domain | 219-278 | SH3 | ||||
Sequence: IPEKNVRALYDFEAAESNELSFVAGDIITITDESNPHWWTGRIGTQQGLFPSSFVTNQLD | ||||||
Domain | 366-383 | ITAM | ||||
Sequence: LYDDAIQKGGFQHQSQGM | ||||||
Compositional bias | 394-416 | Polar residues | ||||
Sequence: QQPPNRAYYPPTGPVQQQQPQQY | ||||||
Region | 394-457 | Disordered | ||||
Sequence: QQPPNRAYYPPTGPVQQQQPQQYPPQHYPAPGAQPQYACPPNSVPQPQQQQQQWPAPSSQPQQY | ||||||
Compositional bias | 417-435 | Pro residues | ||||
Sequence: PPQHYPAPGAQPQYACPPN | ||||||
Compositional bias | 436-457 | Polar residues | ||||
Sequence: SVPQPQQQQQQWPAPSSQPQQY |
Sequence similarities
Belongs to the STAM family.
Keywords
- Domain
Phylogenomic databases
Family and domain databases
Sequence & Isoform
- Sequence statusComplete
This entry describes 2 isoforms produced by Alternative splicing.
O01498-1
This isoform has been chosen as the canonical sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
- Namea
- Length457
- Mass (Da)50,830
- Last updated2001-12-01 v2
- Checksum1AD9B1D83EBE2E16
O01498-2
- Nameb
Features
Showing features for alternative sequence, compositional bias.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Alternative sequence | VSP_052896 | 1-8 | in isoform b | |||
Sequence: Missing | ||||||
Compositional bias | 198-216 | Polar residues | ||||
Sequence: STSTMYPSAKASSPAVQTN | ||||||
Compositional bias | 394-416 | Polar residues | ||||
Sequence: QQPPNRAYYPPTGPVQQQQPQQY | ||||||
Alternative sequence | VSP_052897 | 397-405 | in isoform b | |||
Sequence: PNRAYYPPT → VSFYSEKNI | ||||||
Alternative sequence | VSP_052898 | 406-457 | in isoform b | |||
Sequence: Missing | ||||||
Compositional bias | 417-435 | Pro residues | ||||
Sequence: PPQHYPAPGAQPQYACPPN | ||||||
Compositional bias | 436-457 | Polar residues | ||||
Sequence: SVPQPQQQQQQWPAPSSQPQQY |
Keywords
- Coding sequence diversity
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
FO080778 EMBL· GenBank· DDBJ | CCD66687.1 EMBL· GenBank· DDBJ | Genomic DNA | ||
FO080778 EMBL· GenBank· DDBJ | CCD66688.1 EMBL· GenBank· DDBJ | Genomic DNA |