O01427 · AIR2_CAEEL
- ProteinAurora/IPL1-related protein kinase 2
- Geneair-2
- StatusUniProtKB reviewed (Swiss-Prot)
- Organism
- Amino acids305 (go to sequence)
- Protein existenceEvidence at protein level
- Annotation score5/5
Function
function
Serine/threonine-protein kinase component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of chromosome segregation and cytokinesis (PubMed:10354474, PubMed:10975519, PubMed:10983970, PubMed:11050384, PubMed:11050385, PubMed:12707312, PubMed:9852156).
The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation (PubMed:10983970, PubMed:12707312).
Required for histone H3 phosphorylation during segregation of homologous chromosomes in meiosis and mitosis (PubMed:18923084).
Required for histone H3 'Ser-10' phosphorylation (PubMed:10354474, PubMed:10975519, PubMed:10983970, PubMed:11050384, PubMed:11050385, PubMed:11940606, PubMed:12015116, PubMed:9852156).
Phosphorylates tlk-1 at 'Ser-634', which enhances its activity (PubMed:15916946).
Phosphorylates zen-4 at 'Ser-680' (PubMed:15854913).
Required for the recruitment of bub-1 to the ring-shaped domain between chromosomes during meiotic anaphase I (PubMed:20729837).
Also required for the localization of the condensin I complex subunit smc-4 to mitotic chromosomes (PubMed:11914278).
Acts at the spindle midzone and the midbody to prevent cleavage furrow regression upon chromatin obstructions during cytokinesis (PubMed:12213836, PubMed:23684975).
The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation (PubMed:10983970, PubMed:12707312).
Required for histone H3 phosphorylation during segregation of homologous chromosomes in meiosis and mitosis (PubMed:18923084).
Required for histone H3 'Ser-10' phosphorylation (PubMed:10354474, PubMed:10975519, PubMed:10983970, PubMed:11050384, PubMed:11050385, PubMed:11940606, PubMed:12015116, PubMed:9852156).
Phosphorylates tlk-1 at 'Ser-634', which enhances its activity (PubMed:15916946).
Phosphorylates zen-4 at 'Ser-680' (PubMed:15854913).
Required for the recruitment of bub-1 to the ring-shaped domain between chromosomes during meiotic anaphase I (PubMed:20729837).
Also required for the localization of the condensin I complex subunit smc-4 to mitotic chromosomes (PubMed:11914278).
Acts at the spindle midzone and the midbody to prevent cleavage furrow regression upon chromatin obstructions during cytokinesis (PubMed:12213836, PubMed:23684975).
Catalytic activity
- ATP + L-seryl-[protein] = ADP + H+ + O-phospho-L-seryl-[protein]
Features
Showing features for binding site, active site.
GO annotations
Keywords
- Molecular function
- Biological process
- Ligand
Enzyme and pathway databases
Names & Taxonomy
Protein names
- Recommended nameAurora/IPL1-related protein kinase 2
- EC number
- Alternative names
Gene names
Organism names
- Organism
- Strain
- Taxonomic lineageEukaryota > Metazoa > Ecdysozoa > Nematoda > Chromadorea > Rhabditida > Rhabditina > Rhabditomorpha > Rhabditoidea > Rhabditidae > Peloderinae > Caenorhabditis
Accessions
- Primary accessionO01427
Proteomes
Organism-specific databases
Subcellular Location
UniProt Annotation
GO Annotation
Note: Meiotic and mitotic chromosomes (PubMed:18923084, PubMed:9852156).
During each division, relocates to the midbody microtubules (PubMed:23684975, PubMed:9852156).
Localizes on chromosomes during metaphase and on the central spindle during anaphase (PubMed:23684975, PubMed:25475837).
Localization to homologous chromosomes during segregation is dependent on lab-1 (PubMed:18923084).
During each division, relocates to the midbody microtubules (PubMed:23684975, PubMed:9852156).
Localizes on chromosomes during metaphase and on the central spindle during anaphase (PubMed:23684975, PubMed:25475837).
Localization to homologous chromosomes during segregation is dependent on lab-1 (PubMed:18923084).
Keywords
- Cellular component
Phenotypes & Variants
Disruption phenotype
RNAi-mediated knockdown disrupts the localization of the condensin subunit smc-4 to mitotic chromosomes (PubMed:11914278).
RNAi-mediated knockdown causes failure in mitotic chromosome segregation and cytokinesis, leading to aneuploidy (PubMed:11914278, PubMed:12213836).
RNAi-mediated knockdown causes failure in mitotic chromosome segregation and cytokinesis, leading to aneuploidy (PubMed:11914278, PubMed:12213836).
Features
Showing features for mutagenesis.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Mutagenesis | 155 | Reduced in vitro sumo-1 conjugation. | ||||
Sequence: K → R | ||||||
Mutagenesis | 168 | Reduced in vitro sumo-1 conjugation. | ||||
Sequence: K → R | ||||||
Mutagenesis | 265 | In or207; temperature sensitive. At 15 degrees Celsius, there are no observed changed in meiosis or mitosis. At 20 or 25 degrees Celsius, meiosis appears normal, embryos are not viable and eggs do not complete the first embryonic division due to defects in chromosome segregation and cytokinesis. In these embryos, phosphorylation of histone H3 is abrogated, but this is not abrogated in germ line nuclei. Embryonic viability is increased in a lab-1 tm1791 mutant background and 17% of embryos complete embryogenesis and reach adulthood as fertile animals. Moreover, the phosphorylation of histone H3 defect is rescued in 30% of these embryos. | ||||
Sequence: P → L |
PTM/Processing
Features
Showing features for chain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Chain | PRO_0000268640 | 1-305 | Aurora/IPL1-related protein kinase 2 | |||
Sequence: MENKPPVINLPEKETVNTPQKGGKFTINDFEIGRPLGKGKFGSVYLARTKTGHFHVAIKVLFKSQLISGGVEHQLEREIEIQSHLNHPNIIKLYTYFWDAKKIYLVLEYAPGGEMYKQLTVSKRFSEPTAAKYMYEIADALSYCHRKNVIHRDIKPENLLIGSQGELKIGDFGWSVHAPSNKRQTMCGTMDYLPPEMVNGADHSDAVDLWAIGVLCYEFLVGKPPFEHEDQSKTYAAIKAARFTYPDSVKKGARDLIGRLLVVDPKARCTLEQVKEHYWIQGMMEAKIRAEKQQKIEKEASLRNH |
Post-translational modification
Phosphorylated. Increased phosphorylation upon chromatin obstructions at anaphase.
Keywords
- PTM
Proteomic databases
Expression
Developmental stage
Present during gametogenesis and throughout embryogenesis (at protein level).
Gene expression databases
Interaction
Subunit
Component of the CPC complex which consists of icp-1; csc-1; bir-1 and air-2 (PubMed:12707312).
Within the complex, interacts with icp-1; csc-1 and bir-1 (PubMed:11050385, PubMed:12707312).
Interacts with zen-4 (PubMed:11050384).
Interacts with tlk-1 and bmk-1 (PubMed:15548597, PubMed:15916946).
Within the complex, interacts with icp-1; csc-1 and bir-1 (PubMed:11050385, PubMed:12707312).
Interacts with zen-4 (PubMed:11050384).
Interacts with tlk-1 and bmk-1 (PubMed:15548597, PubMed:15916946).
Binary interactions
Type | Entry 1 | Entry 2 | Number of experiments | Intact | |
---|---|---|---|---|---|
BINARY | O01427 | icp-1 G5EE37 | 4 | EBI-312947, EBI-312981 | |
BINARY | O01427 | lin-10 O17583 | 2 | EBI-312947, EBI-313389 | |
BINARY | O01427 | tlk-1 P34314 | 3 | EBI-312947, EBI-3890382 |
Protein-protein interaction databases
Structure
Family & Domains
Features
Showing features for domain.
Type | ID | Position(s) | Description | |||
---|---|---|---|---|---|---|
Domain | 30-280 | Protein kinase | ||||
Sequence: FEIGRPLGKGKFGSVYLARTKTGHFHVAIKVLFKSQLISGGVEHQLEREIEIQSHLNHPNIIKLYTYFWDAKKIYLVLEYAPGGEMYKQLTVSKRFSEPTAAKYMYEIADALSYCHRKNVIHRDIKPENLLIGSQGELKIGDFGWSVHAPSNKRQTMCGTMDYLPPEMVNGADHSDAVDLWAIGVLCYEFLVGKPPFEHEDQSKTYAAIKAARFTYPDSVKKGARDLIGRLLVVDPKARCTLEQVKEHYWI |
Sequence similarities
Phylogenomic databases
Family and domain databases
Sequence
- Sequence statusComplete
- Length305
- Mass (Da)34,749
- Last updated2000-05-01 v2
- Checksum1635EB60D2E14011
Keywords
- Technical term
Sequence databases
Nucleotide Sequence | Protein Sequence | Molecule Type | Status | |
---|---|---|---|---|
AF071207 EMBL· GenBank· DDBJ | AAC70945.1 EMBL· GenBank· DDBJ | mRNA | ||
BX284601 EMBL· GenBank· DDBJ | CCD61317.1 EMBL· GenBank· DDBJ | Genomic DNA |